BLASTX nr result
ID: Chrysanthemum21_contig00004615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00004615 (942 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 88 1e-18 gb|KQK20681.1| hypothetical protein BRADI_1g63372v3 [Brachypodiu... 86 1e-17 gb|OAY33821.1| hypothetical protein MANES_13G128000 [Manihot esc... 57 2e-10 gb|OEL35491.1| hypothetical protein BAE44_0003490 [Dichanthelium... 63 2e-09 gb|PHT54995.1| ATP synthase subunit alpha, chloroplastic [Capsic... 60 2e-06 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 88.2 bits (217), Expect = 1e-18 Identities = 40/55 (72%), Positives = 46/55 (83%) Frame = +1 Query: 115 INIYIREGIERVAGIEPASLAWKARGYSRRRFIIFNVSNSKPNMKLWFHSAPLWK 279 I + + +RVAGIEPASLAWKA+GYSRRRF +VSNSKPNMKLWFHSAPLW+ Sbjct: 3 IRLVLNNVNKRVAGIEPASLAWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57 >gb|KQK20681.1| hypothetical protein BRADI_1g63372v3 [Brachypodium distachyon] Length = 59 Score = 85.5 bits (210), Expect = 1e-17 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +1 Query: 139 IERVAGIEPASLAWKARGYSRRRFIIFNVSNSKPNMKLWFHSAPLW 276 +ERVAGIEPASLAWKARGYSRR II+NVSNSKPNMK FHSAPLW Sbjct: 1 MERVAGIEPASLAWKARGYSRRWLIIYNVSNSKPNMKFSFHSAPLW 46 >gb|OAY33821.1| hypothetical protein MANES_13G128000 [Manihot esculenta] Length = 72 Score = 57.0 bits (136), Expect(2) = 2e-10 Identities = 28/38 (73%), Positives = 29/38 (76%) Frame = +1 Query: 415 MIPLEEGDSNNLSSYFVLYFYLRGS*GKVFYFHRAKIK 528 MIPL+E D NN SSYFVLY YLR S GK F FHRAK K Sbjct: 1 MIPLDEWDFNNFSSYFVLYSYLRESLGKAFCFHRAKTK 38 Score = 38.1 bits (87), Expect(2) = 2e-10 Identities = 20/31 (64%), Positives = 26/31 (83%), Gaps = 1/31 (3%) Frame = +2 Query: 542 SKLKTFFNSYFASIYSLQIK-KIEDLVTIRN 631 +K K+ FN+YFASI ++Q K +IEDLVTIRN Sbjct: 35 AKTKSAFNAYFASISTIQNKEQIEDLVTIRN 65 >gb|OEL35491.1| hypothetical protein BAE44_0003490 [Dichanthelium oligosanthes] Length = 51 Score = 62.8 bits (151), Expect = 2e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +1 Query: 139 IERVAGIEPASLAWKARGYSRRRFIIFNVSNSKPNMK 249 +ERV GIEP LAWKARGYS R IIFNVSNSKPNMK Sbjct: 14 MERVVGIEPTLLAWKARGYSGRWLIIFNVSNSKPNMK 50 >gb|PHT54995.1| ATP synthase subunit alpha, chloroplastic [Capsicum baccatum] Length = 275 Score = 59.7 bits (143), Expect = 2e-06 Identities = 33/58 (56%), Positives = 44/58 (75%), Gaps = 3/58 (5%) Frame = +2 Query: 437 ILTIFLVTSF---SISI*EDPKEKYFISTELK*NVDVSSKLKTFFNSYFASIYSLQIK 601 I+TI+ T+ S+ + +DP+EK F+STELK VDVSSK K+ FNSYFAS+ SLQI+ Sbjct: 217 IMTIYTRTNSYLDSLEVGQDPEEKEFVSTELKQYVDVSSKPKSSFNSYFASLSSLQIR 274