BLASTX nr result
ID: Chrysanthemum21_contig00004560
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00004560 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021982106.1| putative pentatricopeptide repeat-containing... 55 3e-06 >ref|XP_021982106.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG14747.1| putative rna processing factor 2 [Helianthus annuus] Length = 599 Score = 55.1 bits (131), Expect = 3e-06 Identities = 34/84 (40%), Positives = 47/84 (55%) Frame = +3 Query: 54 LNRTKSFVDAFIRYKYKGNFTITRSFLKSPXXXXXXXXXAGSVMVQDDTPTKLNDALNLF 233 +NRT S + AFI K++GN S SP G+ D T LNDALNLF Sbjct: 2 MNRTNSVLHAFI--KFRGN-----SITNSPFLSFQLGLQYGTHSPVIDKITNLNDALNLF 54 Query: 234 NKMTQQRPLPWADEFTKILKVIRK 305 ++M+Q+RPLP +FT++L + K Sbjct: 55 DEMSQRRPLPSVVKFTQLLNAVTK 78