BLASTX nr result
ID: Chrysanthemum21_contig00004509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00004509 (599 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY98562.1| hypothetical protein LSAT_1X29721 [Lactuca sativa] 57 3e-07 >gb|PLY98562.1| hypothetical protein LSAT_1X29721 [Lactuca sativa] Length = 87 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 4/69 (5%) Frame = -3 Query: 195 SQKQQLINP----LMNAYKEKFLAKHGPDTTKHPAGDMDLWNECTGGKIKGRTFGTSSLS 28 SQ + +N + + Y++ K+GPD ++HP GD+++W C GG+ KGR +G S Sbjct: 11 SQPEHWVNEKSWTIFDKYEKAMCEKYGPDPSQHPLGDVEIWEHCVGGRKKGRVYGVG--S 68 Query: 27 SNPHYVVTG 1 S+P VV G Sbjct: 69 SDPGNVVLG 77