BLASTX nr result
ID: Chrysanthemum21_contig00004354
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00004354 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIW05325.1| hypothetical protein TanjilG_28790 [Lupinus angus... 55 5e-06 >gb|OIW05325.1| hypothetical protein TanjilG_28790 [Lupinus angustifolius] Length = 915 Score = 55.1 bits (131), Expect = 5e-06 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = -1 Query: 408 APQMRRSQIYHGHKETVIMRVFCEKVKFATEELHRSIDYKHNIRNMSVIAHGHYG 244 A ++ +I HG +++ + R VKF EEL R +DYKHNIRNMSVIAH +G Sbjct: 49 AGMVQACRIKHGPRDSNLARSEINHVKFTAEELRRIMDYKHNIRNMSVIAHVDHG 103