BLASTX nr result
ID: Chrysanthemum21_contig00004298
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00004298 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG06260.1| hypothetical protein HannXRQ_Chr12g0382821 [Helia... 59 2e-07 gb|OTG06287.1| hypothetical protein HannXRQ_Chr12g0383121 [Helia... 59 2e-07 >gb|OTG06260.1| hypothetical protein HannXRQ_Chr12g0382821 [Helianthus annuus] Length = 555 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 297 PPWQPVTTAPYATGRVEWRPPWRI-NPSLRTRTF 395 PPW+PV TAP A GR+EWRPPWRI P LRTRTF Sbjct: 251 PPWRPVETAPNAIGRIEWRPPWRIFFPFLRTRTF 284 >gb|OTG06287.1| hypothetical protein HannXRQ_Chr12g0383121 [Helianthus annuus] Length = 603 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 297 PPWQPVTTAPYATGRVEWRPPWRI-NPSLRTRTF 395 PPW+PV TAP A GR+EWRPPWRI P LRTRTF Sbjct: 266 PPWRPVETAPNAIGRIEWRPPWRIFFPFLRTRTF 299 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 297 PPWQPVTTAPYATGRVEWRPPWRI-NPSLRTRTF 395 PPW+PV TAP A GR+EWRPPWRI P LRTRTF Sbjct: 546 PPWRPVETAPNAIGRIEWRPPWRIFFPFLRTRTF 579