BLASTX nr result
ID: Chrysanthemum21_contig00004143
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00004143 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022028750.1| protein REVERSION-TO-ETHYLENE SENSITIVITY1 [... 56 6e-07 >ref|XP_022028750.1| protein REVERSION-TO-ETHYLENE SENSITIVITY1 [Helianthus annuus] ref|XP_022028751.1| protein REVERSION-TO-ETHYLENE SENSITIVITY1 [Helianthus annuus] ref|XP_022028752.1| protein REVERSION-TO-ETHYLENE SENSITIVITY1 [Helianthus annuus] gb|OTG31745.1| Protein of unknown function (DUF778) [Helianthus annuus] Length = 237 Score = 56.2 bits (134), Expect = 6e-07 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -2 Query: 115 MNLVTLAQTCDDEDPIYTKGDKHGFWPLDQIDPAKSRF 2 M LVTLAQ D ED I TKG+ H WPLD+IDP KSRF Sbjct: 1 MKLVTLAQASDVEDLINTKGEDHDLWPLDEIDPTKSRF 38