BLASTX nr result
ID: Chrysanthemum21_contig00003620
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00003620 (799 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] 62 2e-09 gb|OTG11495.1| putative photosystem II PsbH, phosphoprotein [Hel... 64 3e-08 gb|OIT31379.1| pistil-specific extensin-like protein [Nicotiana ... 65 3e-08 ref|YP_009380673.1| hypothetical protein AEK19_MT0281 (mitochond... 56 4e-08 gb|OTG07136.1| putative photosystem II PsbH, phosphoprotein [Hel... 64 4e-08 gb|PNT08306.1| hypothetical protein POPTR_013G140900v3 [Populus ... 59 8e-08 gb|OTG29929.1| putative cytochrome b6/f complex, subunit IV [Hel... 63 2e-07 gb|OTG35047.1| putative photosystem II PsbH, phosphoprotein [Hel... 62 2e-07 gb|KMT19841.1| hypothetical protein BVRB_1g008890 [Beta vulgaris... 53 3e-06 >gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] Length = 39 Score = 62.0 bits (149), Expect = 2e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 694 IRRSRTISIKMTDLFSVLSIGSIITSHTLIFQKYR 798 IRR +TISIKMTD FSVLSIGSIITSHTLIF+KYR Sbjct: 3 IRRDKTISIKMTDPFSVLSIGSIITSHTLIFRKYR 37 >gb|OTG11495.1| putative photosystem II PsbH, phosphoprotein [Helianthus annuus] Length = 250 Score = 63.9 bits (154), Expect = 3e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 89 AVRDESLIYSSRRGDRTYLNKVYDWFEER 3 AVRDESLIYSSRRGDRTYLNKVYDWFEER Sbjct: 72 AVRDESLIYSSRRGDRTYLNKVYDWFEER 100 >gb|OIT31379.1| pistil-specific extensin-like protein [Nicotiana attenuata] Length = 486 Score = 65.1 bits (157), Expect = 3e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 139 SFYYISVPTSIWVFLLELYEMKVSYTVLGGGIAPISIKSMI 17 +FY ISV TSIWVFLLELYEMKVSYTVL GG+ PISI + Sbjct: 10 TFYSISVATSIWVFLLELYEMKVSYTVLRGGVTPISINPRV 50 >ref|YP_009380673.1| hypothetical protein AEK19_MT0281 (mitochondrion) [Utricularia reniformis] gb|ART30557.1| hypothetical protein AEK19_MT0281 (mitochondrion) [Utricularia reniformis] Length = 77 Score = 55.8 bits (133), Expect(2) = 4e-08 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -1 Query: 778 VCDXXXXXXXIVQRIGLSSL*RWFYFVGYFF*YLEHGIYEID 653 +CD IVQRIGLS L RWFYFVGYF YLEH +YEI+ Sbjct: 1 MCDLLELILLIVQRIGLSPLYRWFYFVGYFVEYLEHELYEIN 42 Score = 30.8 bits (68), Expect(2) = 4e-08 Identities = 16/24 (66%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = -2 Query: 654 IKKYLNYDSYL--ICKPRGRTPKR 589 IK YLNYDSYL I +PR R KR Sbjct: 44 IKNYLNYDSYLIIIIRPRVRITKR 67 >gb|OTG07136.1| putative photosystem II PsbH, phosphoprotein [Helianthus annuus] Length = 304 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -3 Query: 89 AVRDESLIYSSRRGDRTYLNKVYDWFEER 3 AVRDESLIYSSRRGDRTYLNKVYDWFEER Sbjct: 72 AVRDESLIYSSRRGDRTYLNKVYDWFEER 100 >gb|PNT08306.1| hypothetical protein POPTR_013G140900v3 [Populus trichocarpa] Length = 72 Score = 58.5 bits (140), Expect = 8e-08 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = +1 Query: 631 IIVQIFLNLFHIFRVPDTR--KNIRRSRTISIKMTDLFSVLSIGSIITSHTLI 783 II IF NLFHIFR PDTR + ++ KMTD FSVLSIGSIITS TLI Sbjct: 2 IIALIFRNLFHIFRAPDTRIISDEVKNHLYQDKMTDPFSVLSIGSIITSRTLI 54 >gb|OTG29929.1| putative cytochrome b6/f complex, subunit IV [Helianthus annuus] Length = 449 Score = 62.8 bits (151), Expect = 2e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 89 AVRDESLIYSSRRGDRTYLNKVYDWFEER 3 +VRDESLIYSSRRGDRTYLNKVYDWFEER Sbjct: 31 SVRDESLIYSSRRGDRTYLNKVYDWFEER 59 >gb|OTG35047.1| putative photosystem II PsbH, phosphoprotein [Helianthus annuus] Length = 304 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 89 AVRDESLIYSSRRGDRTYLNKVYDWFEER 3 AVRDESLIYSSRRGD TYLNKVYDWFEER Sbjct: 72 AVRDESLIYSSRRGDHTYLNKVYDWFEER 100 >gb|KMT19841.1| hypothetical protein BVRB_1g008890 [Beta vulgaris subsp. vulgaris] Length = 36 Score = 53.1 bits (126), Expect = 3e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 460 VLTQGIFGLNLVFLLNHRGSSMNLGF*SIHRVLTR 356 VLTQGIF L+ LLNHRGSSMNLG +IHRVLTR Sbjct: 2 VLTQGIFVLSFRILLNHRGSSMNLGVQAIHRVLTR 36