BLASTX nr result
ID: Chrysanthemum21_contig00003455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00003455 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021969983.1| NADH dehydrogenase [ubiquinone] iron-sulfur ... 54 4e-07 >ref|XP_021969983.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 5-B-like [Helianthus annuus] gb|OTG22659.1| putative NADH-ubiquinone oxidoreductase-related protein [Helianthus annuus] Length = 85 Score = 53.9 bits (128), Expect = 4e-07 Identities = 24/42 (57%), Positives = 25/42 (59%) Frame = +1 Query: 1 CLHHSKEFQRRNRIYXXXXXXXXXXXXXXXSGDVDGEGVPHH 126 CLHHSKEFQRRNRIY GD DG+GVPHH Sbjct: 44 CLHHSKEFQRRNRIYKEEQRQIRAAAQKAKGGDSDGDGVPHH 85