BLASTX nr result
ID: Chrysanthemum21_contig00003256
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00003256 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35991.3| unnamed protein product, partial [Vitis vinifera] 130 2e-36 ref|XP_003564241.1| PREDICTED: 40S ribosomal protein S30 [Brachy... 128 3e-36 gb|PIA64528.1| hypothetical protein AQUCO_00100184v1, partial [A... 129 5e-36 emb|CDY41797.1| BnaC02g12080D [Brassica napus] 129 6e-36 gb|EYU41614.1| hypothetical protein MIMGU_mgv1a016770mg [Erythra... 128 7e-36 ref|XP_003608708.1| 40S ribosomal S30-like protein [Medicago tru... 127 8e-36 gb|KVI01226.1| Ribosomal protein S30 [Cynara cardunculus var. sc... 128 1e-35 gb|POE88827.1| 40s ribosomal protein s30 [Quercus suber] 127 1e-35 ref|XP_006408892.1| 40S ribosomal protein S30 [Eutrema salsugine... 126 2e-35 emb|CDY32875.1| BnaC09g33220D [Brassica napus] 127 2e-35 dbj|BAK06364.1| predicted protein, partial [Hordeum vulgare subs... 126 2e-35 gb|KDO55923.1| hypothetical protein CISIN_1g042287mg, partial [C... 127 2e-35 ref|XP_008375203.1| PREDICTED: 40S ribosomal protein S30 [Malus ... 125 2e-35 ref|NP_001149323.1| uncharacterized protein LOC100282946 [Zea ma... 125 3e-35 ref|XP_006858925.1| 40S ribosomal protein S30 [Amborella trichop... 125 5e-35 gb|PON47830.1| Ribosomal protein [Parasponia andersonii] >gi|133... 125 5e-35 gb|KVH88839.1| Ribosomal protein S30 [Cynara cardunculus var. sc... 126 5e-35 gb|PIA42862.1| hypothetical protein AQUCO_02000366v1, partial [A... 125 6e-35 gb|ESR64610.1| hypothetical protein CICLE_v10009868mg [Citrus cl... 127 7e-35 ref|XP_013681480.2| 40S ribosomal protein S30 [Brassica napus] >... 125 7e-35 >emb|CBI35991.3| unnamed protein product, partial [Vitis vinifera] Length = 113 Score = 130 bits (327), Expect = 2e-36 Identities = 62/70 (88%), Positives = 65/70 (92%) Frame = -2 Query: 416 NQQHQNNTMGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFG 237 N H + MGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAVVGFG Sbjct: 44 NHHHPQSQMGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFG 103 Query: 236 KKRGPNSSEK 207 KKRGPNSSEK Sbjct: 104 KKRGPNSSEK 113 >ref|XP_003564241.1| PREDICTED: 40S ribosomal protein S30 [Brachypodium distachyon] ref|XP_003570358.1| PREDICTED: 40S ribosomal protein S30 [Brachypodium distachyon] ref|XP_020198564.1| 40S ribosomal protein S30 [Aegilops tauschii subsp. tauschii] ref|XP_020157008.1| 40S ribosomal protein S30 [Aegilops tauschii subsp. tauschii] ref|XP_021969806.1| 40S ribosomal protein S30 [Helianthus annuus] ref|XP_021990521.1| 40S ribosomal protein S30 [Helianthus annuus] ref|XP_021996593.1| 40S ribosomal protein S30 [Helianthus annuus] ref|XP_023744461.1| 40S ribosomal protein S30 [Lactuca sativa] ref|XP_023769822.1| 40S ribosomal protein S30 [Lactuca sativa] ref|XP_023735994.1| 40S ribosomal protein S30 [Lactuca sativa] dbj|BAK07914.1| predicted protein [Hordeum vulgare subsp. vulgare] gb|EMS57282.1| 40S ribosomal protein S30 [Triticum urartu] gb|KMZ68630.1| 40S ribosomal protein S30 [Zostera marina] gb|KMZ68631.1| 40S ribosomal protein S30 [Zostera marina] gb|KMZ73102.1| 40S ribosomal protein S30 [Zostera marina] gb|KQK01212.1| hypothetical protein BRADI_3g54495v3 [Brachypodium distachyon] gb|KQK19402.1| hypothetical protein BRADI_1g48060v3 [Brachypodium distachyon] gb|KVI12252.1| Ribosomal protein S30 [Cynara cardunculus var. scolymus] gb|OIW10365.1| hypothetical protein TanjilG_28116 [Lupinus angustifolius] gb|OIW10833.1| hypothetical protein TanjilG_27779 [Lupinus angustifolius] gb|OTG13308.1| putative ribosomal protein S30 [Helianthus annuus] gb|OTG22497.1| putative ribosomal protein S30 [Helianthus annuus] gb|PLY65739.1| hypothetical protein LSAT_5X146160 [Lactuca sativa] gb|PLY72202.1| hypothetical protein LSAT_7X38741 [Lactuca sativa] gb|PLY80885.1| hypothetical protein LSAT_8X87340 [Lactuca sativa] Length = 62 Score = 128 bits (321), Expect = 3e-36 Identities = 62/62 (100%), Positives = 62/62 (100%) Frame = -2 Query: 392 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 213 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS Sbjct: 1 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 60 Query: 212 EK 207 EK Sbjct: 61 EK 62 >gb|PIA64528.1| hypothetical protein AQUCO_00100184v1, partial [Aquilegia coerulea] Length = 103 Score = 129 bits (323), Expect = 5e-36 Identities = 63/71 (88%), Positives = 65/71 (91%) Frame = -2 Query: 419 ENQQHQNNTMGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGF 240 EN TMGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAVVGF Sbjct: 33 ENLTSNLTTMGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGF 92 Query: 239 GKKRGPNSSEK 207 GKKRGPNSSEK Sbjct: 93 GKKRGPNSSEK 103 >emb|CDY41797.1| BnaC02g12080D [Brassica napus] Length = 109 Score = 129 bits (323), Expect = 6e-36 Identities = 61/71 (85%), Positives = 67/71 (94%) Frame = -2 Query: 419 ENQQHQNNTMGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGF 240 + +Q +TMGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+Q+NRRFVTAVVGF Sbjct: 39 KRKQRSKSTMGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRLQHNRRFVTAVVGF 98 Query: 239 GKKRGPNSSEK 207 GKKRGPNSSEK Sbjct: 99 GKKRGPNSSEK 109 >gb|EYU41614.1| hypothetical protein MIMGU_mgv1a016770mg [Erythranthe guttata] Length = 107 Score = 128 bits (322), Expect = 7e-36 Identities = 63/70 (90%), Positives = 69/70 (98%), Gaps = 1/70 (1%) Frame = -2 Query: 413 QQHQNNT-MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFG 237 +++Q+NT MGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAVVGFG Sbjct: 38 RRNQSNTNMGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFG 97 Query: 236 KKRGPNSSEK 207 KKRGPNSSEK Sbjct: 98 KKRGPNSSEK 107 >ref|XP_003608708.1| 40S ribosomal S30-like protein [Medicago truncatula] ref|XP_003611308.1| 40S ribosomal S30-like protein [Medicago truncatula] ref|XP_021641093.1| 40S ribosomal protein S30 [Hevea brasiliensis] gb|AES90905.1| 40S ribosomal S30-like protein [Medicago truncatula] gb|AES94266.1| 40S ribosomal S30-like protein [Medicago truncatula] Length = 62 Score = 127 bits (318), Expect = 8e-36 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -2 Query: 392 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 213 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKR+QYNRRFVTAVVGFGKKRGPNSS Sbjct: 1 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS 60 Query: 212 EK 207 EK Sbjct: 61 EK 62 >gb|KVI01226.1| Ribosomal protein S30 [Cynara cardunculus var. scolymus] Length = 107 Score = 128 bits (321), Expect = 1e-35 Identities = 62/62 (100%), Positives = 62/62 (100%) Frame = -2 Query: 392 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 213 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS Sbjct: 46 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 105 Query: 212 EK 207 EK Sbjct: 106 EK 107 >gb|POE88827.1| 40s ribosomal protein s30 [Quercus suber] Length = 87 Score = 127 bits (319), Expect = 1e-35 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = -2 Query: 395 TMGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNS 216 TMGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAVVGFGKKRGPNS Sbjct: 25 TMGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNS 84 Query: 215 SEK 207 SEK Sbjct: 85 SEK 87 >ref|XP_006408892.1| 40S ribosomal protein S30 [Eutrema salsugineum] gb|ESQ50345.1| hypothetical protein EUTSA_v10002144mg [Eutrema salsugineum] Length = 62 Score = 126 bits (316), Expect = 2e-35 Identities = 61/62 (98%), Positives = 62/62 (100%) Frame = -2 Query: 392 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 213 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQ+NRRFVTAVVGFGKKRGPNSS Sbjct: 1 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQHNRRFVTAVVGFGKKRGPNSS 60 Query: 212 EK 207 EK Sbjct: 61 EK 62 >emb|CDY32875.1| BnaC09g33220D [Brassica napus] Length = 92 Score = 127 bits (318), Expect = 2e-35 Identities = 60/71 (84%), Positives = 66/71 (92%) Frame = -2 Query: 419 ENQQHQNNTMGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGF 240 + +Q + MGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+Q+NRRFVTAVVGF Sbjct: 22 KRKQRSKSAMGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRLQHNRRFVTAVVGF 81 Query: 239 GKKRGPNSSEK 207 GKKRGPNSSEK Sbjct: 82 GKKRGPNSSEK 92 >dbj|BAK06364.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 69 Score = 126 bits (316), Expect = 2e-35 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = -2 Query: 389 GKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSSE 210 GKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSSE Sbjct: 9 GKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSSE 68 Query: 209 K 207 K Sbjct: 69 K 69 >gb|KDO55923.1| hypothetical protein CISIN_1g042287mg, partial [Citrus sinensis] Length = 97 Score = 127 bits (318), Expect = 2e-35 Identities = 64/79 (81%), Positives = 68/79 (86%), Gaps = 7/79 (8%) Frame = -2 Query: 422 EENQQHQNNT-------MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRR 264 ++ QQ Q T MGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRR Sbjct: 19 QQQQQQQRPTRLLKRSAMGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRR 78 Query: 263 FVTAVVGFGKKRGPNSSEK 207 FVTAVVGFGKKRGPNSSEK Sbjct: 79 FVTAVVGFGKKRGPNSSEK 97 >ref|XP_008375203.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_008380830.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_008381137.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_008387171.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_008391295.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_008337951.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_008344217.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_008346709.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_008352418.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_008354614.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_008367943.1| PREDICTED: 40S ribosomal protein S30 [Malus domestica] ref|XP_009355222.1| PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] ref|XP_009367504.1| PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] ref|XP_009337091.1| PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] ref|XP_009338138.1| PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] ref|XP_009344421.1| PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] ref|XP_009344804.1| PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] ref|XP_009347178.1| PREDICTED: 40S ribosomal protein S30 [Pyrus x bretschneideri] gb|PAN08782.1| hypothetical protein PAHAL_A03740 [Panicum hallii] Length = 62 Score = 125 bits (315), Expect = 2e-35 Identities = 60/62 (96%), Positives = 62/62 (100%) Frame = -2 Query: 392 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 213 MGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAVVGFGKKRGPNSS Sbjct: 1 MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRLQYNRRFVTAVVGFGKKRGPNSS 60 Query: 212 EK 207 EK Sbjct: 61 EK 62 >ref|NP_001149323.1| uncharacterized protein LOC100282946 [Zea mays] ref|XP_002318077.1| 40S ribosomal protein S30 [Populus trichocarpa] ref|XP_002322202.1| 40S ribosomal protein S30 [Populus trichocarpa] ref|XP_002281376.1| PREDICTED: 40S ribosomal protein S30 [Vitis vinifera] ref|XP_002283033.1| PREDICTED: 40S ribosomal protein S30 [Vitis vinifera] ref|XP_002454730.1| 40S ribosomal protein S30 [Sorghum bicolor] ref|XP_002436569.1| 40S ribosomal protein S30 [Sorghum bicolor] ref|XP_002514177.1| PREDICTED: 40S ribosomal protein S30 [Ricinus communis] ref|XP_002515895.1| PREDICTED: 40S ribosomal protein S30 [Ricinus communis] ref|XP_003517420.1| PREDICTED: 40S ribosomal protein S30 [Glycine max] ref|XP_003525848.1| PREDICTED: 40S ribosomal protein S30 [Glycine max] ref|XP_003538817.1| PREDICTED: 40S ribosomal protein S30 [Glycine max] ref|XP_004135684.1| PREDICTED: 40S ribosomal protein S30 [Cucumis sativus] ref|XP_004141043.1| PREDICTED: 40S ribosomal protein S30 [Cucumis sativus] ref|XP_004251654.1| PREDICTED: 40S ribosomal protein S30 [Solanum lycopersicum] ref|XP_004287748.1| PREDICTED: 40S ribosomal protein S30 [Fragaria vesca subsp. vesca] ref|XP_004297622.1| PREDICTED: 40S ribosomal protein S30 [Fragaria vesca subsp. vesca] ref|XP_004508905.1| PREDICTED: 40S ribosomal protein S30 [Cicer arietinum] ref|XP_004511685.1| PREDICTED: 40S ribosomal protein S30 [Cicer arietinum] ref|XP_006352915.1| PREDICTED: 40S ribosomal protein S30 [Solanum tuberosum] ref|XP_006353513.1| PREDICTED: 40S ribosomal protein S30 [Solanum tuberosum] ref|XP_006475373.1| PREDICTED: 40S ribosomal protein S30 [Citrus sinensis] ref|XP_006853921.1| 40S ribosomal protein S30 [Amborella trichopoda] ref|XP_007024390.1| PREDICTED: 40S ribosomal protein S30 [Theobroma cacao] ref|XP_007155660.1| hypothetical protein PHAVU_003G220800g [Phaseolus vulgaris] ref|XP_007157355.1| hypothetical protein PHAVU_002G063300g [Phaseolus vulgaris] ref|XP_007215235.1| 40S ribosomal protein S30 [Prunus persica] ref|XP_008241983.1| PREDICTED: 40S ribosomal protein S30 [Prunus mume] ref|XP_008244746.1| PREDICTED: 40S ribosomal protein S30 [Prunus mume] ref|XP_008459180.1| PREDICTED: 40S ribosomal protein S30 [Cucumis melo] ref|XP_008450806.1| PREDICTED: 40S ribosomal protein S30 [Cucumis melo] ref|XP_009624349.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana tomentosiformis] ref|XP_009626192.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana tomentosiformis] ref|XP_009588124.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana tomentosiformis] ref|XP_009794298.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana sylvestris] ref|XP_009790332.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana sylvestris] ref|XP_010267071.1| PREDICTED: 40S ribosomal protein S30 [Nelumbo nucifera] ref|XP_004245996.2| PREDICTED: 40S ribosomal protein S30 [Solanum lycopersicum] ref|XP_011040498.1| PREDICTED: 40S ribosomal protein S30 [Populus euphratica] ref|XP_011014917.1| PREDICTED: 40S ribosomal protein S30 [Populus euphratica] ref|XP_011085776.1| 40S ribosomal protein S30 [Sesamum indicum] ref|XP_011093674.1| 40S ribosomal protein S30 [Sesamum indicum] ref|XP_012076815.1| 40S ribosomal protein S30 [Jatropha curcas] ref|XP_012831909.1| PREDICTED: 40S ribosomal protein S30 [Erythranthe guttata] ref|XP_012845561.1| PREDICTED: 40S ribosomal protein S30 [Erythranthe guttata] ref|XP_014507978.1| 40S ribosomal protein S30 [Vigna radiata var. radiata] ref|XP_014520643.1| 40S ribosomal protein S30 [Vigna radiata var. radiata] ref|XP_015083483.1| PREDICTED: 40S ribosomal protein S30 [Solanum pennellii] ref|XP_015059382.1| PREDICTED: 40S ribosomal protein S30 [Solanum pennellii] ref|XP_015623731.1| PREDICTED: 40S ribosomal protein S30 [Oryza sativa Japonica Group] ref|XP_015644441.1| PREDICTED: 40S ribosomal protein S30 [Oryza sativa Japonica Group] ref|XP_015866631.1| PREDICTED: 40S ribosomal protein S30 [Ziziphus jujuba] ref|XP_015962015.1| 40S ribosomal protein S30 [Arachis duranensis] ref|XP_015964426.1| 40S ribosomal protein S30 [Arachis duranensis] ref|XP_016188282.1| 40S ribosomal protein S30 [Arachis ipaensis] ref|XP_016200666.1| 40S ribosomal protein S30 [Arachis ipaensis] ref|XP_016474572.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] ref|XP_016480718.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] ref|XP_016485434.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] ref|XP_016507476.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] ref|XP_016438944.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] ref|XP_016571468.1| PREDICTED: 40S ribosomal protein S30 [Capsicum annuum] ref|XP_017235880.1| PREDICTED: 40S ribosomal protein S30 [Daucus carota subsp. sativus] ref|XP_017240313.1| PREDICTED: 40S ribosomal protein S30 [Daucus carota subsp. sativus] ref|XP_017428506.1| PREDICTED: 40S ribosomal protein S30 [Vigna angularis] ref|XP_017426528.1| PREDICTED: 40S ribosomal protein S30 [Vigna angularis] ref|XP_018843304.1| PREDICTED: 40S ribosomal protein S30 [Juglans regia] ref|XP_018843305.1| PREDICTED: 40S ribosomal protein S30 [Juglans regia] ref|XP_018809943.1| PREDICTED: 40S ribosomal protein S30 [Juglans regia] ref|XP_019056958.1| PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] ref|XP_019058004.1| PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] ref|XP_019058091.1| PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] ref|XP_019058590.1| PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] ref|XP_019249645.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] ref|XP_019246883.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] ref|XP_019254765.1| PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] ref|XP_020217589.1| 40S ribosomal protein S30 [Cajanus cajan] ref|XP_020228315.1| 40S ribosomal protein S30 [Cajanus cajan] ref|XP_020395077.1| 40S ribosomal protein S30 [Zea mays] ref|XP_020423287.1| 40S ribosomal protein S30 [Prunus persica] ref|XP_020690072.1| 40S ribosomal protein S30 [Dendrobium catenatum] ref|XP_021819535.1| 40S ribosomal protein S30 [Prunus avium] ref|XP_021829647.1| 40S ribosomal protein S30 [Prunus avium] ref|XP_021897725.1| 40S ribosomal protein S30 [Carica papaya] ref|XP_022144845.1| 40S ribosomal protein S30 [Momordica charantia] ref|XP_022154651.1| 40S ribosomal protein S30 [Momordica charantia] ref|XP_022842567.1| 40S ribosomal protein S30 [Olea europaea var. sylvestris] ref|XP_022847148.1| 40S ribosomal protein S30 [Olea europaea var. sylvestris] ref|XP_022933835.1| 40S ribosomal protein S30 [Cucurbita moschata] ref|XP_022946111.1| 40S ribosomal protein S30 [Cucurbita moschata] ref|XP_022961013.1| 40S ribosomal protein S30 [Cucurbita moschata] ref|XP_023005505.1| 40S ribosomal protein S30 [Cucurbita maxima] ref|XP_022987920.1| 40S ribosomal protein S30 [Cucurbita maxima] ref|XP_022999552.1| 40S ribosomal protein S30 [Cucurbita maxima] ref|XP_023531276.1| 40S ribosomal protein S30 [Cucurbita pepo subsp. pepo] ref|XP_023546616.1| 40S ribosomal protein S30 [Cucurbita pepo subsp. pepo] ref|XP_023547013.1| 40S ribosomal protein S30 [Cucurbita pepo subsp. pepo] ref|XP_023870362.1| 40S ribosomal protein S30 [Quercus suber] ref|XP_023926964.1| 40S ribosomal protein S30 [Quercus suber] ref|XP_010086894.2| 40S ribosomal protein S30 [Morus notabilis] ref|XP_024033800.1| 40S ribosomal protein S30 [Citrus clementina] ref|XP_024183670.1| 40S ribosomal protein S30 [Rosa chinensis] ref|XP_024184511.1| 40S ribosomal protein S30 [Rosa chinensis] pdb|3J60|EE Chain e, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome dbj|BAD19414.1| 40S ribosomal protein S30-like [Oryza sativa Japonica Group] dbj|BAD36047.1| 40S ribosomal protein S30-like [Oryza sativa Japonica Group] dbj|BAD72277.1| 40S ribosomal protein S30-like [Oryza sativa Japonica Group] dbj|BAF18855.1| Os06g0172600 [Oryza sativa Japonica Group] gb|ABK93031.1| unknown [Populus trichocarpa] gb|ABK93458.1| unknown [Populus trichocarpa] gb|ABK93562.1| unknown [Populus trichocarpa] gb|ABK93960.1| unknown [Populus trichocarpa] gb|ABK94037.1| unknown [Populus trichocarpa] gb|ABK95737.1| unknown [Populus trichocarpa] gb|ACG25714.1| 40S ribosomal protein S30 [Zea mays] gb|ACG26835.1| 40S ribosomal protein S30 [Zea mays] gb|ACG29907.1| 40S ribosomal protein S30 [Zea mays] gb|ACG30825.1| 40S ribosomal protein S30 [Zea mays] gb|ACG31062.1| 40S ribosomal protein S30 [Zea mays] gb|ACG31470.1| 40S ribosomal protein S30 [Zea mays] gb|ACG35021.1| 40S ribosomal protein S30 [Zea mays] gb|ACG39400.1| 40S ribosomal protein S30 [Zea mays] gb|EEF46315.1| 40S ribosomal protein S30, putative [Ricinus communis] gb|EEF48131.1| 40S ribosomal protein S30, putative [Ricinus communis] gb|EER87936.1| hypothetical protein SORBI_3010G057100 [Sorghum bicolor] gb|EES07706.1| hypothetical protein SORBI_3004G335600 [Sorghum bicolor] gb|ACU20293.1| unknown [Glycine max] gb|AFK44345.1| unknown [Lotus japonicus] gb|AFK48101.1| unknown [Lotus japonicus] gb|AGL08206.1| 40s ribosomal protein S30 [Arachis hypogaea] gb|EOY27012.1| Ribosomal protein S30 family protein [Theobroma cacao] gb|ERN15388.1| hypothetical protein AMTR_s00036p00192320 [Amborella trichopoda] gb|ESW27654.1| hypothetical protein PHAVU_003G220800g [Phaseolus vulgaris] gb|ESW29349.1| hypothetical protein PHAVU_002G063300g [Phaseolus vulgaris] gb|EYU30668.1| hypothetical protein MIMGU_mgv1a017625mg [Erythranthe guttata] gb|EYU30669.1| hypothetical protein MIMGU_mgv1a017625mg [Erythranthe guttata] gb|AHY23246.1| hypothetical protein [Fallopia multiflora] gb|KDP33759.1| hypothetical protein JCGZ_07330 [Jatropha curcas] gb|KGN66198.1| hypothetical protein Csa_1G575140 [Cucumis sativus] gb|KHN09823.1| 40S ribosomal protein S30 [Glycine soja] gb|KHN34938.1| 40S ribosomal protein S30 [Glycine soja] gb|KHN44070.1| 40S ribosomal protein S30 [Glycine soja] dbj|BAS81446.1| Os02g0804100 [Oryza sativa Japonica Group] dbj|BAS96392.1| Os06g0172600 [Oryza sativa Japonica Group] gb|KRH57406.1| hypothetical protein GLYMA_05G059600 [Glycine max] dbj|GAU29334.1| hypothetical protein TSUD_227050 [Trifolium subterraneum] dbj|GAU27826.1| hypothetical protein TSUD_114060 [Trifolium subterraneum] dbj|GAU24499.1| hypothetical protein TSUD_156110 [Trifolium subterraneum] gb|ONH97228.1| hypothetical protein PRUPE_7G177900 [Prunus persica] gb|ONI15656.1| hypothetical protein PRUPE_3G053900 [Prunus persica] gb|AQK75890.1| 40S ribosomal protein S30 [Zea mays] gb|AQK84073.1| 40S ribosomal protein S30 [Zea mays] gb|OVA11728.1| Ribosomal protein S30 [Macleaya cordata] gb|PAN23670.1| hypothetical protein PAHAL_J01630 [Panicum hallii] gb|PAN25554.1| hypothetical protein PAHAL_F02279 [Panicum hallii] gb|PIN21731.1| Ubiquitin-like/40S ribosomal S30 protein fusion [Handroanthus impetiginosus] gb|PKI71777.1| hypothetical protein CRG98_007793 [Punica granatum] gb|PNT01123.1| hypothetical protein POPTR_015G084700v3 [Populus trichocarpa] gb|PNT04920.1| hypothetical protein POPTR_014G147200v3 [Populus trichocarpa] gb|PNT10189.1| hypothetical protein POPTR_012G086600v3 [Populus trichocarpa] gb|PNX77408.1| 40S ribosomal protein s30-like [Trifolium pratense] gb|PON62506.1| Ribosomal protein [Parasponia andersonii] gb|POO00600.1| Ribosomal protein [Trema orientalis] gb|PRQ47275.1| putative ribosomal protein S30 [Rosa chinensis] gb|PRQ51223.1| putative ribosomal protein S30 [Rosa chinensis] Length = 62 Score = 125 bits (314), Expect = 3e-35 Identities = 60/62 (96%), Positives = 62/62 (100%) Frame = -2 Query: 392 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 213 MGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAVVGFGKKRGPNSS Sbjct: 1 MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS 60 Query: 212 EK 207 EK Sbjct: 61 EK 62 >ref|XP_006858925.1| 40S ribosomal protein S30 [Amborella trichopoda] gb|ERN20392.1| hypothetical protein AMTR_s00068p00064720 [Amborella trichopoda] Length = 62 Score = 125 bits (313), Expect = 5e-35 Identities = 59/62 (95%), Positives = 62/62 (100%) Frame = -2 Query: 392 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 213 MGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAV+GFGKKRGPNSS Sbjct: 1 MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVIGFGKKRGPNSS 60 Query: 212 EK 207 EK Sbjct: 61 EK 62 >gb|PON47830.1| Ribosomal protein [Parasponia andersonii] gb|PON75641.1| Ribosomal protein [Trema orientalis] Length = 65 Score = 125 bits (313), Expect = 5e-35 Identities = 60/63 (95%), Positives = 62/63 (98%) Frame = -2 Query: 395 TMGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNS 216 T GKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAVVGFGKKRGPNS Sbjct: 3 TAGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNS 62 Query: 215 SEK 207 SEK Sbjct: 63 SEK 65 >gb|KVH88839.1| Ribosomal protein S30 [Cynara cardunculus var. scolymus] Length = 102 Score = 126 bits (316), Expect = 5e-35 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = -2 Query: 392 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 213 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS Sbjct: 1 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 60 Query: 212 E 210 E Sbjct: 61 E 61 >gb|PIA42862.1| hypothetical protein AQUCO_02000366v1, partial [Aquilegia coerulea] Length = 83 Score = 125 bits (314), Expect = 6e-35 Identities = 60/62 (96%), Positives = 62/62 (100%) Frame = -2 Query: 392 MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSS 213 MGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAVVGFGKKRGPNSS Sbjct: 22 MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS 81 Query: 212 EK 207 EK Sbjct: 82 EK 83 >gb|ESR64610.1| hypothetical protein CICLE_v10009868mg [Citrus clementina] dbj|GAY50417.1| hypothetical protein CUMW_126480 [Citrus unshiu] Length = 133 Score = 127 bits (318), Expect = 7e-35 Identities = 64/79 (81%), Positives = 68/79 (86%), Gaps = 7/79 (8%) Frame = -2 Query: 422 EENQQHQNNT-------MGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRR 264 ++ QQ Q T MGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRR Sbjct: 55 QQQQQQQRPTRLLKRSAMGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRR 114 Query: 263 FVTAVVGFGKKRGPNSSEK 207 FVTAVVGFGKKRGPNSSEK Sbjct: 115 FVTAVVGFGKKRGPNSSEK 133 >ref|XP_013681480.2| 40S ribosomal protein S30 [Brassica napus] emb|CDY43497.1| BnaA01g07470D [Brassica napus] Length = 100 Score = 125 bits (315), Expect = 7e-35 Identities = 60/63 (95%), Positives = 63/63 (100%) Frame = -2 Query: 395 TMGKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNS 216 TMGKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+Q+NRRFVTAVVGFGKKRGPNS Sbjct: 38 TMGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRLQHNRRFVTAVVGFGKKRGPNS 97 Query: 215 SEK 207 SEK Sbjct: 98 SEK 100