BLASTX nr result
ID: Chrysanthemum21_contig00003126
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00003126 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022005320.1| DNA topoisomerase 2-like [Helianthus annuus]... 57 9e-07 ref|XP_021977342.1| DNA topoisomerase 2-like [Helianthus annuus]... 55 7e-06 >ref|XP_022005320.1| DNA topoisomerase 2-like [Helianthus annuus] gb|OTF98638.1| putative DNA topoisomerase 2 [Helianthus annuus] Length = 1488 Score = 57.4 bits (137), Expect = 9e-07 Identities = 40/73 (54%), Positives = 51/73 (69%), Gaps = 9/73 (12%) Frame = -3 Query: 378 PAAA----GQKKALAKNKEKATSIDEQD-ELPA-AERMAKRDF*SSQDVNEIVKL---LA 226 PAAA GQKKA AK K KA+ IDE D E+P+ A+RMA+++ S QD +EIV+L LA Sbjct: 1234 PAAAAKPRGQKKAPAKKKGKASVIDEDDEEIPSLADRMARQNLHSEQDNDEIVQLEDQLA 1293 Query: 225 RHSIESHPKIAYE 187 RH+IES P + E Sbjct: 1294 RHNIESSPDQSQE 1306 >ref|XP_021977342.1| DNA topoisomerase 2-like [Helianthus annuus] gb|OTG37224.1| putative topoisomerase II [Helianthus annuus] Length = 1499 Score = 54.7 bits (130), Expect = 7e-06 Identities = 37/62 (59%), Positives = 46/62 (74%), Gaps = 5/62 (8%) Frame = -3 Query: 372 AAGQKKALAKNKEKATSIDE-QDELPA-AERMAKRDF*SSQDVNEIVKL---LARHSIES 208 AAGQKKA AK K KAT +DE DE+P+ AERMA+++ S QD EIV+L LA+H+IES Sbjct: 1249 AAGQKKAPAKGKGKATLVDEDDDEIPSLAERMAQQNLHSVQD-GEIVELEDRLAKHNIES 1307 Query: 207 HP 202 P Sbjct: 1308 SP 1309