BLASTX nr result
ID: Chrysanthemum21_contig00003113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00003113 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022020515.1| uncharacterized protein LOC110920644 isoform... 73 1e-12 ref|XP_022020513.1| uncharacterized protein LOC110920644 isoform... 73 1e-12 gb|EOY10179.1| PLATZ transcription factor family protein isoform... 69 2e-11 gb|PLY71969.1| hypothetical protein LSAT_3X18360 [Lactuca sativa] 69 3e-11 ref|XP_023769540.1| uncharacterized protein LOC111918107 [Lactuc... 69 4e-11 gb|KHN25848.1| hypothetical protein glysoja_041651 [Glycine soja] 68 6e-11 ref|XP_021282778.1| uncharacterized protein LOC110415440 [Herran... 69 6e-11 ref|XP_007029676.1| PREDICTED: uncharacterized protein LOC185995... 69 6e-11 ref|XP_017410841.1| PREDICTED: uncharacterized protein LOC108323... 68 6e-11 gb|OTG22076.1| putative PLATZ transcription factor family protei... 68 6e-11 ref|XP_008373744.1| PREDICTED: uncharacterized protein LOC103437... 68 7e-11 gb|KRH45433.1| hypothetical protein GLYMA_08G271400, partial [Gl... 68 8e-11 ref|XP_010088252.1| uncharacterized protein LOC21386756 [Morus n... 68 8e-11 ref|XP_019422249.1| PREDICTED: uncharacterized protein LOC109331... 68 8e-11 ref|XP_019445307.1| PREDICTED: uncharacterized protein LOC109349... 68 9e-11 ref|XP_023736231.1| uncharacterized protein LOC111884138 [Lactuc... 69 9e-11 ref|XP_021828060.1| uncharacterized protein LOC110768582 [Prunus... 68 9e-11 ref|XP_007156423.1| hypothetical protein PHAVU_003G2848001g, par... 68 1e-10 ref|XP_014517396.1| uncharacterized protein LOC106774881 [Vigna ... 68 1e-10 ref|XP_022963765.1| uncharacterized protein LOC111463960 [Cucurb... 67 1e-10 >ref|XP_022020515.1| uncharacterized protein LOC110920644 isoform X2 [Helianthus annuus] gb|OTF85091.1| putative PLATZ transcription factor family protein [Helianthus annuus] Length = 227 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPTA TGFRTAKRRKGIPHRAPMGGLVIEY Sbjct: 193 FTPSTPPPTA-TGFRTAKRRKGIPHRAPMGGLVIEY 227 >ref|XP_022020513.1| uncharacterized protein LOC110920644 isoform X1 [Helianthus annuus] Length = 232 Score = 73.2 bits (178), Expect = 1e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPTA TGFRTAKRRKGIPHRAPMGGLVIEY Sbjct: 198 FTPSTPPPTA-TGFRTAKRRKGIPHRAPMGGLVIEY 232 >gb|EOY10179.1| PLATZ transcription factor family protein isoform 2 [Theobroma cacao] Length = 173 Score = 68.6 bits (166), Expect = 2e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPTAV +RTAKRRKG+PHRAPMGGL+IEY Sbjct: 139 FTPSTPPPTAVN-YRTAKRRKGVPHRAPMGGLIIEY 173 >gb|PLY71969.1| hypothetical protein LSAT_3X18360 [Lactuca sativa] Length = 224 Score = 69.3 bits (168), Expect = 3e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPTA + FRTAKRRKGIPHRAPMGGLVIEY Sbjct: 190 FTPSTPPPTAAS-FRTAKRRKGIPHRAPMGGLVIEY 224 >ref|XP_023769540.1| uncharacterized protein LOC111918107 [Lactuca sativa] gb|PLY81088.1| hypothetical protein LSAT_6X79601 [Lactuca sativa] Length = 226 Score = 68.9 bits (167), Expect = 4e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPTA + FRTAKRRKGIPHRAPMGGL+IEY Sbjct: 192 FTPSTPPPTAAS-FRTAKRRKGIPHRAPMGGLIIEY 226 >gb|KHN25848.1| hypothetical protein glysoja_041651 [Glycine soja] Length = 210 Score = 68.2 bits (165), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT+V +RTAKRRKGIPHRAPMGGLVIEY Sbjct: 176 FTPSTPPPTSVN-YRTAKRRKGIPHRAPMGGLVIEY 210 >ref|XP_021282778.1| uncharacterized protein LOC110415440 [Herrania umbratica] Length = 238 Score = 68.6 bits (166), Expect = 6e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPTAV +RTAKRRKG+PHRAPMGGL+IEY Sbjct: 204 FTPSTPPPTAVN-YRTAKRRKGVPHRAPMGGLIIEY 238 >ref|XP_007029676.1| PREDICTED: uncharacterized protein LOC18599587 [Theobroma cacao] gb|EOY10178.1| PLATZ transcription factor family protein isoform 1 [Theobroma cacao] Length = 238 Score = 68.6 bits (166), Expect = 6e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPTAV +RTAKRRKG+PHRAPMGGL+IEY Sbjct: 204 FTPSTPPPTAVN-YRTAKRRKGVPHRAPMGGLIIEY 238 >ref|XP_017410841.1| PREDICTED: uncharacterized protein LOC108323017 isoform X2 [Vigna angularis] gb|KOM31956.1| hypothetical protein LR48_Vigan01g151200 [Vigna angularis] Length = 215 Score = 68.2 bits (165), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT+V +RTAKRRKGIPHRAPMGGLVIEY Sbjct: 181 FTPSTPPPTSVN-YRTAKRRKGIPHRAPMGGLVIEY 215 >gb|OTG22076.1| putative PLATZ transcription factor family protein [Helianthus annuus] Length = 216 Score = 68.2 bits (165), Expect = 6e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPTA + FRTAKRRKGIPHRAPMGGLVIEY Sbjct: 182 FTPSTPPPTAGS-FRTAKRRKGIPHRAPMGGLVIEY 216 >ref|XP_008373744.1| PREDICTED: uncharacterized protein LOC103437059 [Malus domestica] Length = 223 Score = 68.2 bits (165), Expect = 7e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT+ T +RTAKRRKGIPHRAPMGGL+IEY Sbjct: 189 FTPSTPPPTS-TNYRTAKRRKGIPHRAPMGGLIIEY 223 >gb|KRH45433.1| hypothetical protein GLYMA_08G271400, partial [Glycine max] Length = 234 Score = 68.2 bits (165), Expect = 8e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT+V +RTAKRRKGIPHRAPMGGLVIEY Sbjct: 200 FTPSTPPPTSVN-YRTAKRRKGIPHRAPMGGLVIEY 234 >ref|XP_010088252.1| uncharacterized protein LOC21386756 [Morus notabilis] gb|EXB32999.1| hypothetical protein L484_003212 [Morus notabilis] Length = 213 Score = 67.8 bits (164), Expect = 8e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT+V +RTAKRRKGIPHRAPMGGL+IEY Sbjct: 179 FTPSTPPPTSVN-YRTAKRRKGIPHRAPMGGLIIEY 213 >ref|XP_019422249.1| PREDICTED: uncharacterized protein LOC109331911 [Lupinus angustifolius] gb|OIV94447.1| hypothetical protein TanjilG_25509 [Lupinus angustifolius] Length = 214 Score = 67.8 bits (164), Expect = 8e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT+V +RTAKRRKGIPHRAPMGGL+IEY Sbjct: 180 FTPSTPPPTSVN-YRTAKRRKGIPHRAPMGGLIIEY 214 >ref|XP_019445307.1| PREDICTED: uncharacterized protein LOC109349096 [Lupinus angustifolius] gb|OIW10664.1| hypothetical protein TanjilG_16036 [Lupinus angustifolius] Length = 215 Score = 67.8 bits (164), Expect = 9e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT+V +RTAKRRKGIPHRAPMGGL+IEY Sbjct: 181 FTPSTPPPTSVN-YRTAKRRKGIPHRAPMGGLIIEY 215 >ref|XP_023736231.1| uncharacterized protein LOC111884138 [Lactuca sativa] Length = 375 Score = 69.3 bits (168), Expect = 9e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPTA + FRTAKRRKGIPHRAPMGGLVIEY Sbjct: 341 FTPSTPPPTAAS-FRTAKRRKGIPHRAPMGGLVIEY 375 >ref|XP_021828060.1| uncharacterized protein LOC110768582 [Prunus avium] Length = 216 Score = 67.8 bits (164), Expect = 9e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT+V +RTAKRRKGIPHRAPMGGL+IEY Sbjct: 182 FTPSTPPPTSVN-YRTAKRRKGIPHRAPMGGLIIEY 216 >ref|XP_007156423.1| hypothetical protein PHAVU_003G2848001g, partial [Phaseolus vulgaris] gb|ESW28417.1| hypothetical protein PHAVU_003G2848001g, partial [Phaseolus vulgaris] Length = 259 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT+V +RTAKRRKGIPHRAPMGGLVIEY Sbjct: 225 FTPSTPPPTSVN-YRTAKRRKGIPHRAPMGGLVIEY 259 >ref|XP_014517396.1| uncharacterized protein LOC106774881 [Vigna radiata var. radiata] Length = 262 Score = 68.2 bits (165), Expect = 1e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT+V +RTAKRRKGIPHRAPMGGLVIEY Sbjct: 228 FTPSTPPPTSVN-YRTAKRRKGIPHRAPMGGLVIEY 262 >ref|XP_022963765.1| uncharacterized protein LOC111463960 [Cucurbita moschata] ref|XP_022967442.1| uncharacterized protein LOC111466981 [Cucurbita maxima] ref|XP_023553670.1| uncharacterized protein LOC111811153 [Cucurbita pepo subsp. pepo] Length = 212 Score = 67.4 bits (163), Expect = 1e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 411 FTPSTPPPTAVTGFRTAKRRKGIPHRAPMGGLVIEY 304 FTPSTPPPT V+ +RTAKRRKGIPHRAPMGGL+IEY Sbjct: 178 FTPSTPPPTLVS-YRTAKRRKGIPHRAPMGGLIIEY 212