BLASTX nr result
ID: Chrysanthemum21_contig00002423
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00002423 (597 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022009781.1| G2/mitotic-specific cyclin-2-like [Helianthu... 50 8e-07 >ref|XP_022009781.1| G2/mitotic-specific cyclin-2-like [Helianthus annuus] gb|OTF98144.1| putative G2/mitotic-specific cyclin-2 [Helianthus annuus] Length = 425 Score = 50.4 bits (119), Expect(2) = 8e-07 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +1 Query: 310 EIANKKQCLPEETKKLNGSEEGFGVWQD 393 EIANKKQC+ EE KK+N S EGFGVW+D Sbjct: 79 EIANKKQCIQEEIKKINESNEGFGVWED 106 Score = 30.4 bits (67), Expect(2) = 8e-07 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 15/59 (25%) Frame = +3 Query: 174 QSLYPGKGEVMGGRKFG-----LQRALSESNQNLDR---------GHGH-CLAKKRTSS 305 ++ + G+ +V+G +KFG +RALS NQNLD G H C+A KR S Sbjct: 15 RNTHQGERDVIGAKKFGGEIGHKRRALSVINQNLDNCGGGVKRTGGRVHPCVASKRALS 73