BLASTX nr result
ID: Chrysanthemum21_contig00002344
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00002344 (654 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF99094.1| hypothetical protein HannXRQ_Chr14g0452821 [Helia... 62 2e-09 gb|PLY94773.1| hypothetical protein LSAT_2X98621 [Lactuca sativa] 54 1e-06 >gb|OTF99094.1| hypothetical protein HannXRQ_Chr14g0452821 [Helianthus annuus] Length = 59 Score = 61.6 bits (148), Expect = 2e-09 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -3 Query: 490 MMTLNDMARSMRMAQVTKSLLVETIPLQIVPAMKPSCAPRLATI 359 MMTLNDM RSMRM + KS+L ET PLQIVP +KPSCAPRLATI Sbjct: 1 MMTLNDMTRSMRMVR-PKSVL-ETAPLQIVPPIKPSCAPRLATI 42 >gb|PLY94773.1| hypothetical protein LSAT_2X98621 [Lactuca sativa] Length = 53 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -3 Query: 487 MTLNDMARSMRMAQVTKSLLVETIPLQIVPAMKPSCAPRLATI 359 MTLNDMARS+RM +V L+ET P QIV +KPS APRLATI Sbjct: 1 MTLNDMARSIRMVRVKS--LIETAPFQIVTPIKPSSAPRLATI 41