BLASTX nr result
ID: Chrysanthemum21_contig00001851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00001851 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022849197.1| queuine tRNA-ribosyltransferase accessory su... 69 1e-10 ref|XP_022849196.1| queuine tRNA-ribosyltransferase accessory su... 69 1e-10 ref|XP_018622391.1| PREDICTED: queuine tRNA-ribosyltransferase a... 65 3e-10 ref|XP_022013753.1| queuine tRNA-ribosyltransferase accessory su... 67 3e-10 ref|XP_021903623.1| queuine tRNA-ribosyltransferase accessory su... 67 4e-10 ref|XP_018622390.1| PREDICTED: queuine tRNA-ribosyltransferase a... 65 4e-10 ref|XP_009586997.1| PREDICTED: queuine tRNA-ribosyltransferase a... 65 6e-10 ref|XP_004516911.1| PREDICTED: queuine tRNA-ribosyltransferase s... 66 7e-10 gb|PLY84617.1| hypothetical protein LSAT_1X25281 [Lactuca sativa] 65 1e-09 ref|XP_023764956.1| queuine tRNA-ribosyltransferase accessory su... 65 1e-09 dbj|GAV64514.1| TGT domain-containing protein [Cephalotus follic... 65 2e-09 ref|XP_019240874.1| PREDICTED: queuine tRNA-ribosyltransferase a... 65 2e-09 ref|XP_016475178.1| PREDICTED: queuine tRNA-ribosyltransferase s... 65 2e-09 ref|XP_019240873.1| PREDICTED: queuine tRNA-ribosyltransferase a... 65 3e-09 ref|XP_016475177.1| PREDICTED: queuine tRNA-ribosyltransferase s... 65 3e-09 gb|KRH46952.1| hypothetical protein GLYMA_08G367700 [Glycine max] 61 3e-09 gb|KYP67897.1| Queuine tRNA-ribosyltransferase subunit QTRTD1 [C... 63 3e-09 ref|XP_010264839.1| PREDICTED: queuine tRNA-ribosyltransferase a... 63 1e-08 ref|XP_010264838.1| PREDICTED: queuine tRNA-ribosyltransferase a... 63 1e-08 ref|XP_020214037.1| queuine tRNA-ribosyltransferase accessory su... 63 1e-08 >ref|XP_022849197.1| queuine tRNA-ribosyltransferase accessory subunit 2-like isoform X2 [Olea europaea var. sylvestris] Length = 360 Score = 68.6 bits (166), Expect = 1e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFRLIREAIKEG+FE+ R+KFI SRRDH Sbjct: 315 HNTHHYLGFFRLIREAIKEGRFEQFREKFIRSRRDH 350 >ref|XP_022849196.1| queuine tRNA-ribosyltransferase accessory subunit 2-like isoform X1 [Olea europaea var. sylvestris] Length = 400 Score = 68.6 bits (166), Expect = 1e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFRLIREAIKEG+FE+ R+KFI SRRDH Sbjct: 355 HNTHHYLGFFRLIREAIKEGRFEQFREKFIRSRRDH 390 >ref|XP_018622391.1| PREDICTED: queuine tRNA-ribosyltransferase accessory subunit-like isoform X3 [Nicotiana tomentosiformis] Length = 152 Score = 64.7 bits (156), Expect = 3e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFR IREAI+EGKFE+ RQKFI SRR+H Sbjct: 109 HNTHHYLGFFRSIREAIQEGKFEQFRQKFIGSRREH 144 >ref|XP_022013753.1| queuine tRNA-ribosyltransferase accessory subunit 2-like [Helianthus annuus] gb|OTG33654.1| putative queuine tRNA-ribosyltransferase subunit qtrtd1 [Helianthus annuus] Length = 427 Score = 67.4 bits (163), Expect = 3e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFRLIREAI EGKFEE RQKFI++RR H Sbjct: 376 HNTHHYLSFFRLIREAITEGKFEEFRQKFIQNRRGH 411 >ref|XP_021903623.1| queuine tRNA-ribosyltransferase accessory subunit 2-like [Carica papaya] Length = 397 Score = 67.0 bits (162), Expect = 4e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL+FFR IR+AIK G FEE RQKF++SRRDH Sbjct: 354 HNTHHYLMFFRSIRDAIKAGNFEEFRQKFVQSRRDH 389 >ref|XP_018622390.1| PREDICTED: queuine tRNA-ribosyltransferase accessory subunit-like isoform X2 [Nicotiana tomentosiformis] Length = 177 Score = 64.7 bits (156), Expect = 4e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFR IREAI+EGKFE+ RQKFI SRR+H Sbjct: 134 HNTHHYLGFFRSIREAIQEGKFEQFRQKFIGSRREH 169 >ref|XP_009586997.1| PREDICTED: queuine tRNA-ribosyltransferase accessory subunit-like isoform X1 [Nicotiana tomentosiformis] Length = 192 Score = 64.7 bits (156), Expect = 6e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFR IREAI+EGKFE+ RQKFI SRR+H Sbjct: 149 HNTHHYLGFFRSIREAIQEGKFEQFRQKFIGSRREH 184 >ref|XP_004516911.1| PREDICTED: queuine tRNA-ribosyltransferase subunit qtrtd1-like [Cicer arietinum] Length = 424 Score = 66.2 bits (160), Expect = 7e-10 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL+FFR+IREAI+EG+FE RQ FIESRR+H Sbjct: 358 HNTHHYLMFFRVIREAIQEGRFENYRQTFIESRREH 393 >gb|PLY84617.1| hypothetical protein LSAT_1X25281 [Lactuca sativa] Length = 444 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FF +IREAI EG+FEELRQ FIE RRDH Sbjct: 391 HNTHHYLSFFGVIREAITEGRFEELRQNFIEKRRDH 426 >ref|XP_023764956.1| queuine tRNA-ribosyltransferase accessory subunit 2-like [Lactuca sativa] Length = 445 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FF +IREAI EG+FEELRQ FIE RRDH Sbjct: 391 HNTHHYLSFFGVIREAITEGRFEELRQNFIEKRRDH 426 >dbj|GAV64514.1| TGT domain-containing protein [Cephalotus follicularis] Length = 422 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFR +RE+IKEGKFE+ RQ FI+SRRDH Sbjct: 379 HNTHHYLGFFRSMRESIKEGKFEQFRQNFIQSRRDH 414 >ref|XP_019240874.1| PREDICTED: queuine tRNA-ribosyltransferase accessory subunit 2-like isoform X2 [Nicotiana attenuata] gb|OIT19912.1| hypothetical protein A4A49_39583 [Nicotiana attenuata] Length = 398 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFR IREAI+EGKFE+ RQKFI SRR+H Sbjct: 355 HNTHHYLGFFRSIREAIQEGKFEQFRQKFIGSRREH 390 >ref|XP_016475178.1| PREDICTED: queuine tRNA-ribosyltransferase subunit qtrtd1-like isoform X2 [Nicotiana tabacum] Length = 398 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFR IREAI+EGKFE+ RQKFI SRR+H Sbjct: 355 HNTHHYLGFFRSIREAIQEGKFEQFRQKFIGSRREH 390 >ref|XP_019240873.1| PREDICTED: queuine tRNA-ribosyltransferase accessory subunit 2-like isoform X1 [Nicotiana attenuata] Length = 413 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFR IREAI+EGKFE+ RQKFI SRR+H Sbjct: 370 HNTHHYLGFFRSIREAIQEGKFEQFRQKFIGSRREH 405 >ref|XP_016475177.1| PREDICTED: queuine tRNA-ribosyltransferase subunit qtrtd1-like isoform X1 [Nicotiana tabacum] Length = 427 Score = 64.7 bits (156), Expect = 3e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFR IREAI+EGKFE+ RQKFI SRR+H Sbjct: 384 HNTHHYLGFFRSIREAIQEGKFEQFRQKFIGSRREH 419 >gb|KRH46952.1| hypothetical protein GLYMA_08G367700 [Glycine max] Length = 99 Score = 60.8 bits (146), Expect = 3e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FF +IREAIK+G+FE+ RQ FI+SRR H Sbjct: 39 HNTHHYLAFFLVIREAIKDGRFEKFRQTFIQSRRAH 74 >gb|KYP67897.1| Queuine tRNA-ribosyltransferase subunit QTRTD1 [Cajanus cajan] Length = 191 Score = 62.8 bits (151), Expect = 3e-09 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FF +IREAIK+G+FE+ RQ FIESRR H Sbjct: 148 HNTHHYLTFFHVIREAIKDGRFEKFRQTFIESRRAH 183 >ref|XP_010264839.1| PREDICTED: queuine tRNA-ribosyltransferase accessory subunit 2-like isoform X3 [Nelumbo nucifera] Length = 333 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFRLIREAIKEGKFE QKFI++RR H Sbjct: 290 HNTHHYLGFFRLIREAIKEGKFELFCQKFIQTRRGH 325 >ref|XP_010264838.1| PREDICTED: queuine tRNA-ribosyltransferase accessory subunit 2-like isoform X2 [Nelumbo nucifera] Length = 341 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FFRLIREAIKEGKFE QKFI++RR H Sbjct: 298 HNTHHYLGFFRLIREAIKEGKFELFCQKFIQTRRGH 333 >ref|XP_020214037.1| queuine tRNA-ribosyltransferase accessory subunit 2-like [Cajanus cajan] Length = 398 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 437 HNTHHYLLFFRLIREAIKEGKFEELRQKFIESRRDH 330 HNTHHYL FF +IREAIK+G+FE+ RQ FIESRR H Sbjct: 355 HNTHHYLTFFHVIREAIKDGRFEKFRQTFIESRRAH 390