BLASTX nr result
ID: Chrysanthemum21_contig00001673
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00001673 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022006474.1| sedoheptulose-1,7-bisphosphatase, chloroplas... 63 1e-08 gb|KVI09903.1| Fructose-1,6-bisphosphatase, active site-containi... 60 1e-07 ref|XP_023752923.1| sedoheptulose-1,7-bisphosphatase, chloroplas... 59 4e-07 >ref|XP_022006474.1| sedoheptulose-1,7-bisphosphatase, chloroplastic-like [Helianthus annuus] gb|OTF99740.1| putative sedoheptulose-1,7-bisphosphatase protein [Helianthus annuus] Length = 392 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 314 METSVACFARGTILPSVASQHTTSFASPRSISP 412 MET VACFARGTI P+VASQHTTSFASPRSISP Sbjct: 1 METGVACFARGTISPTVASQHTTSFASPRSISP 33 >gb|KVI09903.1| Fructose-1,6-bisphosphatase, active site-containing protein [Cynara cardunculus var. scolymus] Length = 377 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 314 METSVACFARGTILPSVASQHTTSFASPRSISP 412 MET VACFARGTILP++ASQH+TSFASP S+SP Sbjct: 1 METGVACFARGTILPTIASQHSTSFASPWSVSP 33 >ref|XP_023752923.1| sedoheptulose-1,7-bisphosphatase, chloroplastic [Lactuca sativa] gb|PLY93719.1| hypothetical protein LSAT_2X122641 [Lactuca sativa] Length = 393 Score = 58.5 bits (140), Expect = 4e-07 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = +2 Query: 314 METSVACFARGTILPSVASQHTT-SFASPRSISP 412 MET VACFAR TILPSVASQHTT SFASPR+ISP Sbjct: 1 METGVACFARATILPSVASQHTTSSFASPRTISP 34