BLASTX nr result
ID: Chrysanthemum21_contig00001628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00001628 (902 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020550651.1| signal peptide peptidase-like 2, partial [Se... 57 2e-06 gb|OTG21928.1| putative PA domain, Presenilin/signal peptide pep... 59 6e-06 >ref|XP_020550651.1| signal peptide peptidase-like 2, partial [Sesamum indicum] Length = 153 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 814 VKVQTWVNGVEGPEFVGVGARFGTTIVSK 900 VKVQTWVNGVE EFVGVGARFGTTIVSK Sbjct: 51 VKVQTWVNGVEDEEFVGVGARFGTTIVSK 79 >gb|OTG21928.1| putative PA domain, Presenilin/signal peptide peptidase [Helianthus annuus] Length = 498 Score = 58.5 bits (140), Expect = 6e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 793 TLESCY*VKVQTWVNGVEGPEFVGVGARFGTTIVSK 900 TL VKVQTWV+GVEG EFVGVGARFGTTIVSK Sbjct: 15 TLSCVLQVKVQTWVDGVEGAEFVGVGARFGTTIVSK 50