BLASTX nr result
ID: Chrysanthemum21_contig00001477
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00001477 (742 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFK22681.1| hypothetical protein AALP_AAs42556U000100 [Arabis... 57 2e-07 ref|XP_009397826.1| PREDICTED: uncharacterized membrane protein ... 60 2e-07 gb|KJB37683.1| hypothetical protein B456_006G217400 [Gossypium r... 56 2e-07 gb|EOA16966.1| hypothetical protein CARUB_v10005194mg, partial [... 56 3e-07 dbj|BAD43504.1| unknown protein [Arabidopsis thaliana] 56 3e-07 ref|NP_567541.1| SNARE associated Golgi protein family [Arabidop... 56 3e-07 gb|AAM65735.1| unknown [Arabidopsis thaliana] 56 3e-07 ref|XP_006284068.2| uncharacterized membrane protein At4g09580 [... 56 3e-07 ref|XP_002870084.1| uncharacterized membrane protein At4g09580 [... 56 3e-07 ref|XP_006414186.1| uncharacterized membrane protein At4g09580 [... 56 3e-07 ref|XP_018453264.1| PREDICTED: uncharacterized membrane protein ... 56 3e-07 gb|ABD65614.1| hypothetical protein 23.t00026 [Brassica oleracea] 56 3e-07 ref|XP_013638001.1| PREDICTED: uncharacterized membrane protein ... 56 3e-07 ref|XP_009130958.1| PREDICTED: uncharacterized membrane protein ... 56 3e-07 ref|XP_013711905.1| uncharacterized membrane protein At4g09580 [... 56 3e-07 ref|XP_013723400.1| uncharacterized membrane protein At4g09580 [... 56 3e-07 gb|PLY81045.1| hypothetical protein LSAT_6X80261 [Lactuca sativa] 60 5e-07 ref|XP_022029221.1| uncharacterized membrane protein At4g09580-l... 60 6e-07 ref|XP_010530019.1| PREDICTED: uncharacterized membrane protein ... 57 7e-07 ref|XP_010439940.1| PREDICTED: uncharacterized membrane protein ... 56 7e-07 >gb|KFK22681.1| hypothetical protein AALP_AAs42556U000100 [Arabis alpina] Length = 260 Score = 56.6 bits (135), Expect(2) = 2e-07 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V+IFMQTFMIPGTV MSLLA +FGV Sbjct: 77 IYTSDYTVQVLVGYCLVYIFMQTFMIPGTVFMSLLA--GALFGV 118 Score = 26.9 bits (58), Expect(2) = 2e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 72 RDNLEIYTSDY 82 >ref|XP_009397826.1| PREDICTED: uncharacterized membrane protein At4g09580 [Musa acuminata subsp. malaccensis] ref|XP_018679976.1| PREDICTED: uncharacterized membrane protein At4g09580 [Musa acuminata subsp. malaccensis] Length = 248 Score = 59.7 bits (143), Expect(2) = 2e-07 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 619 TTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 T YT+Q+LVG CTV+IFMQTFMIPGT+ MSLLA GSL FGV Sbjct: 64 TDYTIQVLVGYCTVYIFMQTFMIPGTIFMSLLA-GSL-FGV 102 Score = 23.9 bits (50), Expect(2) = 2e-07 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE YT+DY Sbjct: 56 RDNLESYTTDY 66 >gb|KJB37683.1| hypothetical protein B456_006G217400 [Gossypium raimondii] Length = 193 Score = 55.8 bits (133), Expect(2) = 2e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YT+Q+LVG C V+IFMQTFMIPGTV MSLLA +FGV Sbjct: 10 IYTSDYTLQVLVGYCAVYIFMQTFMIPGTVFMSLLA--GALFGV 51 Score = 27.7 bits (60), Expect(2) = 2e-07 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +3 Query: 576 IYYCGRDNLEVYTSDY 623 +Y+C RD+LE+YTSDY Sbjct: 1 MYHC-RDHLEIYTSDY 15 >gb|EOA16966.1| hypothetical protein CARUB_v10005194mg, partial [Capsella rubella] Length = 339 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 156 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 197 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 151 RDNLEIYTSDY 161 >dbj|BAD43504.1| unknown protein [Arabidopsis thaliana] Length = 264 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 81 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 122 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 76 RDNLEIYTSDY 86 >ref|NP_567541.1| SNARE associated Golgi protein family [Arabidopsis thaliana] emb|CAB10559.1| hypothetical protein [Arabidopsis thaliana] emb|CAB78782.1| hypothetical protein [Arabidopsis thaliana] dbj|BAD42949.1| unknown protein [Arabidopsis thaliana] dbj|BAD94198.1| hypothetical protein [Arabidopsis thaliana] gb|AEE83951.1| SNARE associated Golgi protein family [Arabidopsis thaliana] gb|OAO98171.1| hypothetical protein AXX17_AT4G20930 [Arabidopsis thaliana] Length = 264 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 81 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 122 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 76 RDNLEIYTSDY 86 >gb|AAM65735.1| unknown [Arabidopsis thaliana] Length = 264 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 81 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 122 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 76 RDNLEIYTSDY 86 >ref|XP_006284068.2| uncharacterized membrane protein At4g09580 [Capsella rubella] Length = 262 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 79 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 120 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 74 RDNLEIYTSDY 84 >ref|XP_002870084.1| uncharacterized membrane protein At4g09580 [Arabidopsis lyrata subsp. lyrata] gb|EFH46343.1| hypothetical protein ARALYDRAFT_914922 [Arabidopsis lyrata subsp. lyrata] Length = 260 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 77 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 118 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 72 RDNLEIYTSDY 82 >ref|XP_006414186.1| uncharacterized membrane protein At4g09580 [Eutrema salsugineum] gb|ESQ55639.1| hypothetical protein EUTSA_v10026024mg [Eutrema salsugineum] Length = 258 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 75 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 116 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 70 RDNLEIYTSDY 80 >ref|XP_018453264.1| PREDICTED: uncharacterized membrane protein At4g09580-like [Raphanus sativus] Length = 257 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 74 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 115 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 69 RDNLEIYTSDY 79 >gb|ABD65614.1| hypothetical protein 23.t00026 [Brassica oleracea] Length = 257 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 74 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 115 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 69 RDNLEIYTSDY 79 >ref|XP_013638001.1| PREDICTED: uncharacterized membrane protein At4g09580-like [Brassica oleracea var. oleracea] Length = 257 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 74 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 115 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 69 RDNLEIYTSDY 79 >ref|XP_009130958.1| PREDICTED: uncharacterized membrane protein At4g09580-like [Brassica rapa] Length = 257 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 74 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 115 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 69 RDNLEIYTSDY 79 >ref|XP_013711905.1| uncharacterized membrane protein At4g09580 [Brassica napus] Length = 257 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 74 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 115 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 69 RDNLEIYTSDY 79 >ref|XP_013723400.1| uncharacterized membrane protein At4g09580 [Brassica napus] emb|CDY54781.1| BnaAnng13520D [Brassica napus] Length = 257 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 74 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 115 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE+YTSDY Sbjct: 69 RDNLEIYTSDY 79 >gb|PLY81045.1| hypothetical protein LSAT_6X80261 [Lactuca sativa] Length = 232 Score = 59.7 bits (143), Expect = 5e-07 Identities = 36/53 (67%), Positives = 41/53 (77%) Frame = +1 Query: 583 IVAEIISRYIQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I+ + RY + YTVQ+LVG CTV+IFMQTFMIPGTV MSLLA GSL FGV Sbjct: 41 ILRNHLERY--TSDYTVQVLVGYCTVYIFMQTFMIPGTVFMSLLA-GSL-FGV 89 >ref|XP_022029221.1| uncharacterized membrane protein At4g09580-like [Helianthus annuus] gb|OTG32160.1| putative SNARE associated Golgi protein [Helianthus annuus] Length = 276 Score = 60.1 bits (144), Expect = 6e-07 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = +1 Query: 583 IVAEIISRYIQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I+ + + RY + YT+Q+LVG CTV+IFMQTFMIPGTV MSLLA GSL FGV Sbjct: 85 ILRDNLERY--TSDYTIQVLVGYCTVYIFMQTFMIPGTVFMSLLA-GSL-FGV 133 >ref|XP_010530019.1| PREDICTED: uncharacterized membrane protein At4g09580-like isoform X1 [Tarenaya hassleriana] ref|XP_019057285.1| PREDICTED: uncharacterized membrane protein At4g09580-like isoform X2 [Tarenaya hassleriana] Length = 263 Score = 57.0 bits (136), Expect(2) = 7e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 625 YTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 YT+Q+LVG C V+IFMQTFMIPGTV MSLLA G +FGV Sbjct: 85 YTIQVLVGYCLVYIFMQTFMIPGTVFMSLLAGG--LFGV 121 Score = 25.0 bits (53), Expect(2) = 7e-07 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +3 Query: 591 RDNLEVYTSDY 623 RDNLE YTSDY Sbjct: 75 RDNLESYTSDY 85 >ref|XP_010439940.1| PREDICTED: uncharacterized membrane protein At4g09580-like isoform X2 [Camelina sativa] Length = 262 Score = 56.2 bits (134), Expect(2) = 7e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 610 IQVTTYTVQLLVGCCTVHIFMQTFMIPGTVCMSLLARGSLVFGV 741 I + YTVQ+LVG C V++FMQTFMIPGTV MSLLA +FGV Sbjct: 79 IYTSDYTVQVLVGYCLVYVFMQTFMIPGTVFMSLLA--GALFGV 120 Score = 25.8 bits (55), Expect(2) = 7e-07 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +3 Query: 591 RDNLEVYTSDY 623 +DNLE+YTSDY Sbjct: 74 KDNLEIYTSDY 84