BLASTX nr result
ID: Chrysanthemum21_contig00000966
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00000966 (634 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524762.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 89 6e-22 ref|XP_018814711.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 87 6e-21 gb|PNT37892.1| hypothetical protein POPTR_005G211600v3 [Populus ... 86 2e-20 ref|XP_002307594.1| transducin family protein [Populus trichocarpa] 86 2e-20 gb|PNT37893.1| hypothetical protein POPTR_005G211600v3 [Populus ... 86 2e-20 ref|XP_011032679.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 86 2e-20 ref|XP_021680552.1| tRNA (guanine-N(7)-)-methyltransferase non-c... 85 4e-20 ref|XP_021614458.1| tRNA (guanine-N(7)-)-methyltransferase non-c... 85 4e-20 gb|POE49850.1| trna (guanine-n(7)-)-methyltransferase non-cataly... 84 5e-20 gb|PON94934.1| Guanine nucleotide-binding protein, beta subunit ... 84 5e-20 ref|XP_022035545.1| tRNA (guanine-N(7)-)-methyltransferase non-c... 87 5e-20 ref|XP_023901199.1| tRNA (guanine-N(7)-)-methyltransferase non-c... 84 5e-20 ref|XP_018856115.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 84 6e-20 ref|XP_024045299.1| LOW QUALITY PROTEIN: tRNA (guanine-N(7)-)-me... 85 8e-20 gb|KDO68684.1| hypothetical protein CISIN_1g013631mg [Citrus sin... 85 8e-20 ref|XP_006479695.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 85 8e-20 gb|PON55236.1| Guanine nucleotide-binding protein, beta subunit ... 84 8e-20 dbj|GAY40664.1| hypothetical protein CUMW_053700, partial [Citru... 85 8e-20 gb|ESR57279.1| hypothetical protein CICLE_v10020269mg [Citrus cl... 85 8e-20 dbj|GAY40663.1| hypothetical protein CUMW_053700, partial [Citru... 85 8e-20 >ref|XP_002524762.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Ricinus communis] gb|EEF37605.1| WD-repeat protein, putative [Ricinus communis] Length = 435 Score = 88.6 bits (218), Expect(2) = 6e-22 Identities = 44/49 (89%), Positives = 47/49 (95%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 NQ+LV KKASPLLAHYCSIITSLEFSPDG+FIV+ADRDFKIRVT FPKK Sbjct: 141 NQSLVNKKASPLLAHYCSIITSLEFSPDGRFIVSADRDFKIRVTVFPKK 189 Score = 43.9 bits (102), Expect(2) = 6e-22 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+TLDGAHEI SFCLGHTE Sbjct: 187 PKKTLDGAHEIQSFCLGHTE 206 >ref|XP_018814711.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4-like [Juglans regia] Length = 433 Score = 87.4 bits (215), Expect(2) = 6e-21 Identities = 43/49 (87%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 NQALV KKA P+LAHYCSIITSLEFSPDG+FIV+ADRDFKIRVT FPKK Sbjct: 138 NQALVNKKAGPILAHYCSIITSLEFSPDGRFIVSADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 6e-21 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >gb|PNT37892.1| hypothetical protein POPTR_005G211600v3 [Populus trichocarpa] Length = 440 Score = 85.5 bits (210), Expect(2) = 2e-20 Identities = 43/49 (87%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 N+ LV KKA+PLLAHYCSIITSLEFSPDG FIVTADRDFKIRVT FPKK Sbjct: 138 NETLVNKKAAPLLAHYCSIITSLEFSPDGWFIVTADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 2e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >ref|XP_002307594.1| transducin family protein [Populus trichocarpa] Length = 440 Score = 85.5 bits (210), Expect(2) = 2e-20 Identities = 43/49 (87%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 N+ LV KKA+PLLAHYCSIITSLEFSPDG FIVTADRDFKIRVT FPKK Sbjct: 138 NETLVNKKAAPLLAHYCSIITSLEFSPDGWFIVTADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 2e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >gb|PNT37893.1| hypothetical protein POPTR_005G211600v3 [Populus trichocarpa] Length = 432 Score = 85.5 bits (210), Expect(2) = 2e-20 Identities = 43/49 (87%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 N+ LV KKA+PLLAHYCSIITSLEFSPDG FIVTADRDFKIRVT FPKK Sbjct: 138 NETLVNKKAAPLLAHYCSIITSLEFSPDGWFIVTADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 2e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >ref|XP_011032679.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Populus euphratica] ref|XP_011032680.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Populus euphratica] Length = 432 Score = 85.5 bits (210), Expect(2) = 2e-20 Identities = 43/49 (87%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 N+ LV KKA+PLLAHYCSIITSLEFSPDG FIVTADRDFKIRVT FPKK Sbjct: 138 NETLVNKKAAPLLAHYCSIITSLEFSPDGWFIVTADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 2e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >ref|XP_021680552.1| tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Hevea brasiliensis] Length = 432 Score = 84.7 bits (208), Expect(2) = 4e-20 Identities = 41/49 (83%), Positives = 47/49 (95%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 N++LV +KA+PLLAHYCSIITSLEFSPDG+FIV+ADRDFKIRVT FPKK Sbjct: 138 NESLVSRKAAPLLAHYCSIITSLEFSPDGQFIVSADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 4e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >ref|XP_021614458.1| tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Manihot esculenta] gb|OAY49746.1| hypothetical protein MANES_05G079700 [Manihot esculenta] Length = 432 Score = 84.7 bits (208), Expect(2) = 4e-20 Identities = 41/49 (83%), Positives = 47/49 (95%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 N++LV +KA+PLLAHYCSIITSLEFSPDG+FIV+ADRDFKIRVT FPKK Sbjct: 138 NESLVNRKAAPLLAHYCSIITSLEFSPDGQFIVSADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 4e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >gb|POE49850.1| trna (guanine-n(7)-)-methyltransferase non-catalytic subunit wdr4 [Quercus suber] Length = 639 Score = 84.3 bits (207), Expect(2) = 5e-20 Identities = 40/49 (81%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 NQ L KKA+PLLAHYCSIITSLEFSPDG+F+++ADRDFKIRVT FPKK Sbjct: 138 NQMLANKKAAPLLAHYCSIITSLEFSPDGRFVISADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 5e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >gb|PON94934.1| Guanine nucleotide-binding protein, beta subunit [Trema orientalis] Length = 439 Score = 84.3 bits (207), Expect(2) = 5e-20 Identities = 42/48 (87%), Positives = 45/48 (93%), Gaps = 1/48 (2%) Frame = -2 Query: 288 QALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 QA V KKA+PLL+HYCSIITSLEFSPDGKFIV+ADRDFKIRVT FPKK Sbjct: 139 QAAVDKKAAPLLSHYCSIITSLEFSPDGKFIVSADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 5e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >ref|XP_022035545.1| tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Helianthus annuus] gb|OTG29138.1| putative transducin/WD40 repeat-like superfamily protein [Helianthus annuus] Length = 438 Score = 87.4 bits (215), Expect(2) = 5e-20 Identities = 43/49 (87%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 NQA VQKK SPLL+HYCSIITSLEFSPDG+FI+TADRDFKIRVT FPKK Sbjct: 144 NQASVQKKGSPLLSHYCSIITSLEFSPDGQFIITADRDFKIRVTVFPKK 192 Score = 38.5 bits (88), Expect(2) = 5e-20 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ L+GAHEI S+CLGHTE Sbjct: 190 PKKPLNGAHEIQSYCLGHTE 209 >ref|XP_023901199.1| tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Quercus suber] Length = 429 Score = 84.3 bits (207), Expect(2) = 5e-20 Identities = 40/49 (81%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 NQ L KKA+PLLAHYCSIITSLEFSPDG+F+++ADRDFKIRVT FPKK Sbjct: 138 NQMLANKKAAPLLAHYCSIITSLEFSPDGRFVISADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 5e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >ref|XP_018856115.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Juglans regia] Length = 434 Score = 84.0 bits (206), Expect(2) = 6e-20 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 1/50 (2%) Frame = -2 Query: 294 TNQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 +NQALV KKA +LAHYCSIITSLEFSPDG+FIV+ADRDFKIRVT FPKK Sbjct: 138 SNQALVNKKAVQMLAHYCSIITSLEFSPDGRFIVSADRDFKIRVTVFPKK 187 Score = 41.6 bits (96), Expect(2) = 6e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 185 PKKPLDGAHEIQSFCLGHTE 204 >ref|XP_024045299.1| LOW QUALITY PROTEIN: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Citrus clementina] Length = 453 Score = 84.7 bits (208), Expect(2) = 8e-20 Identities = 41/48 (85%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPK 151 NQA+V KKA+PLLAHYCSIITSLEFSPDG+FI++ADRDFKIRVT FPK Sbjct: 160 NQAVVDKKAAPLLAHYCSIITSLEFSPDGQFIISADRDFKIRVTVFPK 207 Score = 40.4 bits (93), Expect(2) = 8e-20 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK LDGAHEI SFCLGHTE Sbjct: 206 PKGPLDGAHEIQSFCLGHTE 225 >gb|KDO68684.1| hypothetical protein CISIN_1g013631mg [Citrus sinensis] Length = 439 Score = 84.7 bits (208), Expect(2) = 8e-20 Identities = 41/48 (85%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPK 151 NQA+V KKA+PLLAHYCSIITSLEFSPDG+FI++ADRDFKIRVT FPK Sbjct: 146 NQAVVDKKAAPLLAHYCSIITSLEFSPDGQFIISADRDFKIRVTVFPK 193 Score = 40.4 bits (93), Expect(2) = 8e-20 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK LDGAHEI SFCLGHTE Sbjct: 192 PKGPLDGAHEIQSFCLGHTE 211 >ref|XP_006479695.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 [Citrus sinensis] Length = 439 Score = 84.7 bits (208), Expect(2) = 8e-20 Identities = 41/48 (85%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPK 151 NQA+V KKA+PLLAHYCSIITSLEFSPDG+FI++ADRDFKIRVT FPK Sbjct: 146 NQAVVDKKAAPLLAHYCSIITSLEFSPDGQFIISADRDFKIRVTVFPK 193 Score = 40.4 bits (93), Expect(2) = 8e-20 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK LDGAHEI SFCLGHTE Sbjct: 192 PKGPLDGAHEIQSFCLGHTE 211 >gb|PON55236.1| Guanine nucleotide-binding protein, beta subunit [Parasponia andersonii] Length = 436 Score = 83.6 bits (205), Expect(2) = 8e-20 Identities = 41/48 (85%), Positives = 45/48 (93%), Gaps = 1/48 (2%) Frame = -2 Query: 288 QALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPKK 148 QA V KKA+PLL+HYCSIITSLEFSPDGKF+V+ADRDFKIRVT FPKK Sbjct: 139 QAAVNKKAAPLLSHYCSIITSLEFSPDGKFLVSADRDFKIRVTVFPKK 186 Score = 41.6 bits (96), Expect(2) = 8e-20 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK+ LDGAHEI SFCLGHTE Sbjct: 184 PKKPLDGAHEIQSFCLGHTE 203 >dbj|GAY40664.1| hypothetical protein CUMW_053700, partial [Citrus unshiu] Length = 426 Score = 84.7 bits (208), Expect(2) = 8e-20 Identities = 41/48 (85%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPK 151 NQA+V KKA+PLLAHYCSIITSLEFSPDG+FI++ADRDFKIRVT FPK Sbjct: 149 NQAVVDKKAAPLLAHYCSIITSLEFSPDGQFIISADRDFKIRVTVFPK 196 Score = 40.4 bits (93), Expect(2) = 8e-20 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK LDGAHEI SFCLGHTE Sbjct: 195 PKGPLDGAHEIQSFCLGHTE 214 >gb|ESR57279.1| hypothetical protein CICLE_v10020269mg [Citrus clementina] Length = 426 Score = 84.7 bits (208), Expect(2) = 8e-20 Identities = 41/48 (85%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPK 151 NQA+V KKA+PLLAHYCSIITSLEFSPDG+FI++ADRDFKIRVT FPK Sbjct: 133 NQAVVDKKAAPLLAHYCSIITSLEFSPDGQFIISADRDFKIRVTVFPK 180 Score = 40.4 bits (93), Expect(2) = 8e-20 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK LDGAHEI SFCLGHTE Sbjct: 179 PKGPLDGAHEIQSFCLGHTE 198 >dbj|GAY40663.1| hypothetical protein CUMW_053700, partial [Citrus unshiu] Length = 421 Score = 84.7 bits (208), Expect(2) = 8e-20 Identities = 41/48 (85%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = -2 Query: 291 NQALVQKKASPLLAHYCSIITSLEFSPDGKFIVTADRDFKIRVT-FPK 151 NQA+V KKA+PLLAHYCSIITSLEFSPDG+FI++ADRDFKIRVT FPK Sbjct: 144 NQAVVDKKAAPLLAHYCSIITSLEFSPDGQFIISADRDFKIRVTVFPK 191 Score = 40.4 bits (93), Expect(2) = 8e-20 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 157 PKETLDGAHEIDSFCLGHTE 98 PK LDGAHEI SFCLGHTE Sbjct: 190 PKGPLDGAHEIQSFCLGHTE 209