BLASTX nr result
ID: Chrysanthemum21_contig00000922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00000922 (1611 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJY66654.1| hypothetical protein OXYTRI_13059 (macronuclear) ... 82 3e-15 gb|KXN87149.1| hypothetical protein AN958_09135 [Leucoagaricus s... 63 4e-09 ref|XP_013946733.1| hypothetical protein TRIATDRAFT_255346 [Tric... 63 4e-09 gb|OQD93834.1| hypothetical protein PENVUL_c172G01260, partial [... 62 7e-09 gb|KNA06142.1| hypothetical protein SOVF_183600 [Spinacia oleracea] 62 7e-09 gb|OJJ66804.1| hypothetical protein ASPBRDRAFT_366689 [Aspergill... 62 1e-08 ref|XP_022576478.1| hypothetical protein ASPZODRAFT_1284245 [Pen... 62 1e-08 gb|OCK86501.1| hypothetical protein K441DRAFT_93587 [Cenococcum ... 62 1e-08 gb|PKK62552.1| hypothetical protein RhiirC2_814430 [Rhizophagus ... 62 1e-08 gb|OEU06062.1| hypothetical protein FRACYDRAFT_202768, partial [... 62 1e-08 gb|ORY18469.1| hypothetical protein BCR33DRAFT_822100 [Rhizoclos... 62 1e-08 gb|KII82787.1| hypothetical protein PLICRDRAFT_58628 [Plicaturop... 62 1e-08 gb|PKK64980.1| hypothetical protein RhiirC2_665695 [Rhizophagus ... 62 1e-08 gb|PKX99747.1| hypothetical protein P168DRAFT_245600, partial [A... 62 1e-08 ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, parti... 62 1e-08 gb|ORY18460.1| hypothetical protein BCR33DRAFT_672880, partial [... 62 1e-08 gb|OCL10867.1| hypothetical protein AOQ84DRAFT_396602 [Glonium s... 62 1e-08 ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipol... 62 1e-08 gb|PLB42937.1| hypothetical protein P170DRAFT_318339, partial [A... 62 1e-08 gb|PKX88176.1| hypothetical protein P174DRAFT_380988, partial [A... 62 1e-08 >gb|EJY66654.1| hypothetical protein OXYTRI_13059 (macronuclear) [Oxytricha trifallax] Length = 111 Score = 82.4 bits (202), Expect = 3e-15 Identities = 45/90 (50%), Positives = 55/90 (61%) Frame = +1 Query: 919 ADYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTRRAV*NKPI*IAYQMASIHMSPNALRL 1098 ++YE FN NNFN+ Y SWNYRGCWHQTCP I R+ V I I +S + L Sbjct: 19 SNYELFNCNNFNIRYWSWNYRGCWHQTCPPIDPRKGVQILLIAIPKHRLRSVISCHYLPE 78 Query: 1099 CPMGTLRACCLP*KCEQSLRPTLQDRTLIL 1188 +G LRACCLP + LR L++RTLIL Sbjct: 79 SGLGNLRACCLPQMWQPFLRLPLRNRTLIL 108 >gb|KXN87149.1| hypothetical protein AN958_09135 [Leucoagaricus sp. SymC.cos] Length = 58 Score = 63.2 bits (152), Expect = 4e-09 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIV 1014 +YE FN NNFN+CY SWNY GCWHQTCP IV Sbjct: 26 NYELFNCNNFNICYWSWNYHGCWHQTCPPIV 56 >ref|XP_013946733.1| hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] Length = 59 Score = 63.2 bits (152), Expect = 4e-09 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 27 NYELFNHNNFNIRYWSWNYRGCWHQTCPPIVPR 59 >gb|OQD93834.1| hypothetical protein PENVUL_c172G01260, partial [Penicillium vulpinum] Length = 42 Score = 62.0 bits (149), Expect = 7e-09 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 10 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 42 >gb|KNA06142.1| hypothetical protein SOVF_183600 [Spinacia oleracea] Length = 59 Score = 62.4 bits (150), Expect = 7e-09 Identities = 33/66 (50%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +1 Query: 829 FDRR--PPSILHGAPLTGAADPLRVSGF*RSGADYERFNRNNFNVCY*SWNYRGCWHQTC 1002 F RR P +H TG P +YE FN NNFN+ Y SWNYRGCWHQTC Sbjct: 3 FPRRKGPAGPVHAVRRTGQPGPR---------FNYELFNCNNFNIRYWSWNYRGCWHQTC 53 Query: 1003 PLIVTR 1020 P IV R Sbjct: 54 PPIVPR 59 >gb|OJJ66804.1| hypothetical protein ASPBRDRAFT_366689 [Aspergillus brasiliensis CBS 101740] gb|PKX88230.1| hypothetical protein P174DRAFT_380900 [Aspergillus novofumigatus IBT 16806] gb|PKX88271.1| hypothetical protein P174DRAFT_380764 [Aspergillus novofumigatus IBT 16806] gb|PLB42889.1| hypothetical protein P170DRAFT_371182 [Aspergillus steynii IBT 23096] gb|PLB42918.1| hypothetical protein P170DRAFT_451513 [Aspergillus steynii IBT 23096] Length = 59 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 27 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 59 >ref|XP_022576478.1| hypothetical protein ASPZODRAFT_1284245 [Penicilliopsis zonata CBS 506.65] gb|OJJ41968.1| hypothetical protein ASPZODRAFT_1284245 [Penicilliopsis zonata CBS 506.65] Length = 59 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 27 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 59 >gb|OCK86501.1| hypothetical protein K441DRAFT_93587 [Cenococcum geophilum 1.58] gb|PMD28727.1| hypothetical protein L207DRAFT_550212 [Meliniomyces variabilis F] Length = 59 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 27 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 59 >gb|PKK62552.1| hypothetical protein RhiirC2_814430 [Rhizophagus irregularis] gb|PKK71647.1| hypothetical protein RhiirC2_418192 [Rhizophagus irregularis] gb|PKK73798.1| hypothetical protein RhiirC2_324014 [Rhizophagus irregularis] Length = 61 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 29 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 61 >gb|OEU06062.1| hypothetical protein FRACYDRAFT_202768, partial [Fragilariopsis cylindrus CCMP1102] gb|OEU06065.1| hypothetical protein FRACYDRAFT_202699, partial [Fragilariopsis cylindrus CCMP1102] Length = 75 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 877 AADPLRVSGF*RSGADYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +A +++ + ++YE FN NNFN+ Y SWNYRGCWHQTCP I TR Sbjct: 28 SAQTNKIANWTHHKSNYELFNCNNFNIRYWSWNYRGCWHQTCPPIDTR 75 >gb|ORY18469.1| hypothetical protein BCR33DRAFT_822100 [Rhizoclosmatium globosum] Length = 64 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 32 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 64 >gb|KII82787.1| hypothetical protein PLICRDRAFT_58628 [Plicaturopsis crispa FD-325 SS-3] Length = 64 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 32 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 64 >gb|PKK64980.1| hypothetical protein RhiirC2_665695 [Rhizophagus irregularis] Length = 76 Score = 62.4 bits (150), Expect = 1e-08 Identities = 32/72 (44%), Positives = 41/72 (56%) Frame = +1 Query: 805 NPKVKREAFDRRPPSILHGAPLTGAADPLRVSGF*RSGADYERFNRNNFNVCY*SWNYRG 984 NP+ ++ +R P S+ H R++ +YE FN NNFN+ Y SWNYRG Sbjct: 12 NPRNQQNKIER-PISLFHANVFK------RMTNLLTPKFNYELFNCNNFNIRYWSWNYRG 64 Query: 985 CWHQTCPLIVTR 1020 CWHQTCP IV R Sbjct: 65 CWHQTCPPIVPR 76 >gb|PKX99747.1| hypothetical protein P168DRAFT_245600, partial [Aspergillus campestris IBT 28561] gb|PKX99777.1| hypothetical protein P168DRAFT_245433, partial [Aspergillus campestris IBT 28561] gb|PLB42828.1| hypothetical protein P170DRAFT_371383, partial [Aspergillus steynii IBT 23096] gb|PLB42858.1| hypothetical protein P170DRAFT_371258, partial [Aspergillus steynii IBT 23096] gb|PLB42913.1| hypothetical protein P170DRAFT_371091, partial [Aspergillus steynii IBT 23096] gb|PLB45342.1| hypothetical protein P170DRAFT_366700, partial [Aspergillus steynii IBT 23096] Length = 66 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 34 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 66 >ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] gb|EJF55554.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] Length = 66 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 34 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 66 >gb|ORY18460.1| hypothetical protein BCR33DRAFT_672880, partial [Rhizoclosmatium globosum] gb|ORY18480.1| hypothetical protein BCR33DRAFT_672809, partial [Rhizoclosmatium globosum] gb|ORY18492.1| hypothetical protein BCR33DRAFT_672873, partial [Rhizoclosmatium globosum] gb|ORY37502.1| hypothetical protein BCR33DRAFT_663557, partial [Rhizoclosmatium globosum] Length = 66 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 34 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 66 >gb|OCL10867.1| hypothetical protein AOQ84DRAFT_396602 [Glonium stellatum] Length = 68 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 36 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 68 >ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] ref|XP_014072420.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gb|EUC26718.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] Length = 68 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 36 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 68 >gb|PLB42937.1| hypothetical protein P170DRAFT_318339, partial [Aspergillus steynii IBT 23096] Length = 69 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 37 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 69 >gb|PKX88176.1| hypothetical protein P174DRAFT_380988, partial [Aspergillus novofumigatus IBT 16806] gb|PKX88238.1| hypothetical protein P174DRAFT_380919, partial [Aspergillus novofumigatus IBT 16806] gb|PKX89134.1| hypothetical protein P174DRAFT_379364, partial [Aspergillus novofumigatus IBT 16806] gb|PKX93496.1| hypothetical protein P174DRAFT_372206, partial [Aspergillus novofumigatus IBT 16806] gb|PKX93506.1| hypothetical protein P174DRAFT_371845, partial [Aspergillus novofumigatus IBT 16806] gb|PKX99715.1| hypothetical protein P168DRAFT_245651, partial [Aspergillus campestris IBT 28561] gb|PKX99737.1| hypothetical protein P168DRAFT_245596, partial [Aspergillus campestris IBT 28561] gb|PKX99761.1| hypothetical protein P168DRAFT_245505, partial [Aspergillus campestris IBT 28561] gb|PKX99786.1| hypothetical protein P168DRAFT_245472, partial [Aspergillus campestris IBT 28561] gb|PKX99794.1| hypothetical protein P168DRAFT_245447, partial [Aspergillus campestris IBT 28561] gb|PKX99801.1| hypothetical protein P168DRAFT_245390, partial [Aspergillus campestris IBT 28561] gb|PKX99810.1| hypothetical protein P168DRAFT_245350, partial [Aspergillus campestris IBT 28561] gb|PKX99821.1| hypothetical protein P168DRAFT_245369, partial [Aspergillus campestris IBT 28561] gb|PKX99830.1| hypothetical protein P168DRAFT_245347, partial [Aspergillus campestris IBT 28561] gb|PKY04581.1| hypothetical protein P168DRAFT_236091, partial [Aspergillus campestris IBT 28561] gb|PLB42745.1| hypothetical protein P170DRAFT_371641, partial [Aspergillus steynii IBT 23096] gb|PLB42770.1| hypothetical protein P170DRAFT_371577, partial [Aspergillus steynii IBT 23096] gb|PLB42780.1| hypothetical protein P170DRAFT_371547, partial [Aspergillus steynii IBT 23096] gb|PLB42796.1| hypothetical protein P170DRAFT_371518, partial [Aspergillus steynii IBT 23096] gb|PLB42797.1| hypothetical protein P170DRAFT_371467, partial [Aspergillus steynii IBT 23096] gb|PLB42803.1| hypothetical protein P170DRAFT_371478, partial [Aspergillus steynii IBT 23096] gb|PLB42804.1| hypothetical protein P170DRAFT_371441, partial [Aspergillus steynii IBT 23096] gb|PLB42813.1| hypothetical protein P170DRAFT_371414, partial [Aspergillus steynii IBT 23096] gb|PLB42847.1| hypothetical protein P170DRAFT_371284, partial [Aspergillus steynii IBT 23096] gb|PLB42874.1| hypothetical protein P170DRAFT_371218, partial [Aspergillus steynii IBT 23096] gb|PLB42882.1| hypothetical protein P170DRAFT_371201, partial [Aspergillus steynii IBT 23096] gb|PLB42903.1| hypothetical protein P170DRAFT_371082, partial [Aspergillus steynii IBT 23096] gb|PLB42928.1| hypothetical protein P170DRAFT_371049, partial [Aspergillus steynii IBT 23096] gb|PLB42938.1| hypothetical protein P170DRAFT_370989, partial [Aspergillus steynii IBT 23096] gb|PLB42947.1| hypothetical protein P170DRAFT_371001, partial [Aspergillus steynii IBT 23096] gb|PLB42958.1| hypothetical protein P170DRAFT_370959, partial [Aspergillus steynii IBT 23096] gb|PLB42971.1| hypothetical protein P170DRAFT_370924, partial [Aspergillus steynii IBT 23096] gb|PLB42981.1| hypothetical protein P170DRAFT_370885, partial [Aspergillus steynii IBT 23096] gb|PLB42992.1| hypothetical protein P170DRAFT_370801, partial [Aspergillus steynii IBT 23096] gb|PLB43001.1| hypothetical protein P170DRAFT_370765, partial [Aspergillus steynii IBT 23096] gb|PLB43012.1| hypothetical protein P170DRAFT_370854, partial [Aspergillus steynii IBT 23096] gb|PLB43023.1| hypothetical protein P170DRAFT_370757, partial [Aspergillus steynii IBT 23096] gb|PLB43033.1| hypothetical protein P170DRAFT_370746, partial [Aspergillus steynii IBT 23096] gb|PLB43044.1| hypothetical protein P170DRAFT_370719, partial [Aspergillus steynii IBT 23096] gb|PLB43062.1| hypothetical protein P170DRAFT_370612, partial [Aspergillus steynii IBT 23096] gb|PLB43074.1| hypothetical protein P170DRAFT_370579, partial [Aspergillus steynii IBT 23096] Length = 70 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 922 DYERFNRNNFNVCY*SWNYRGCWHQTCPLIVTR 1020 +YE FN NNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 38 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 70