BLASTX nr result
ID: Chrysanthemum21_contig00000805
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00000805 (960 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023764295.1| gamma-interferon-inducible lysosomal thiol r... 72 7e-11 >ref|XP_023764295.1| gamma-interferon-inducible lysosomal thiol reductase-like [Lactuca sativa] gb|PLY98363.1| hypothetical protein LSAT_5X174401 [Lactuca sativa] Length = 267 Score = 72.4 bits (176), Expect = 7e-11 Identities = 38/58 (65%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -1 Query: 960 PTLPKACLRCLASPENH-VGDSVDKVIPLNPVTYPEDSSNPLLSKFRSTLMSLMFKRN 790 PTLPKACLRCLA EN + DK+IPL+PVTYPE S+NPL SK RS+LMS +F N Sbjct: 208 PTLPKACLRCLALSENRMISAPQDKLIPLHPVTYPE-SANPLFSKIRSSLMSWIFMEN 264