BLASTX nr result
ID: Chrysanthemum21_contig00000697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00000697 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH91665.1| Armadillo-type fold [Cynara cardunculus var. scol... 65 1e-09 >gb|KVH91665.1| Armadillo-type fold [Cynara cardunculus var. scolymus] Length = 1053 Score = 65.5 bits (158), Expect = 1e-09 Identities = 45/109 (41%), Positives = 57/109 (52%), Gaps = 9/109 (8%) Frame = -1 Query: 429 IIQNFSVRDKEQTAEVESEEASPEIHXXXXXKADSAPSVSQEKNKD---------LS*KS 277 I+Q FSVRD+EQ E +S EASPE H K D APS SQEKNKD S K+ Sbjct: 866 ILQEFSVRDEEQATEAQSAEASPETHKKKKSKTDPAPSASQEKNKDSAKRVGEASSSGKT 925 Query: 276 KASGSKDTKSKPAN*RKVKTHRKRVPKPSKRPQRLLTSQKRLFETVPKS 130 K + SKD KSK + K T +K K + + + + E PK+ Sbjct: 926 KGTASKDHKSKDMSAAK-STSQKTSGKSTDAAASKESGKSKEDEETPKA 973