BLASTX nr result
ID: Chrysanthemum21_contig00000322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00000322 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI09034.1| Pentatricopeptide repeat-containing protein [Cyna... 144 7e-37 ref|XP_021973702.1| pentatricopeptide repeat-containing protein ... 138 6e-35 ref|XP_021832308.1| putative pentatricopeptide repeat-containing... 134 2e-33 ref|XP_017241718.1| PREDICTED: pentatricopeptide repeat-containi... 134 3e-33 gb|OVA05194.1| Pentatricopeptide repeat [Macleaya cordata] 132 7e-33 ref|XP_008226293.1| PREDICTED: pentatricopeptide repeat-containi... 132 7e-33 ref|XP_007213606.1| putative pentatricopeptide repeat-containing... 132 7e-33 ref|XP_022879414.1| pentatricopeptide repeat-containing protein ... 132 7e-33 ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containi... 132 7e-33 ref|XP_008383032.1| PREDICTED: pentatricopeptide repeat-containi... 132 9e-33 ref|XP_023729035.1| pentatricopeptide repeat-containing protein ... 131 2e-32 ref|XP_018506254.1| PREDICTED: pentatricopeptide repeat-containi... 131 2e-32 gb|OTF97939.1| putative DYW domain-containing protein [Helianthu... 122 2e-32 ref|XP_003622422.1| pentatricopeptide (PPR) repeat protein [Medi... 131 3e-32 gb|KHN27741.1| Pentatricopeptide repeat-containing protein, chlo... 127 5e-32 ref|XP_019185691.1| PREDICTED: pentatricopeptide repeat-containi... 129 8e-32 ref|XP_021758272.1| pentatricopeptide repeat-containing protein ... 129 8e-32 ref|XP_021725463.1| pentatricopeptide repeat-containing protein ... 129 9e-32 ref|XP_016440885.1| PREDICTED: pentatricopeptide repeat-containi... 126 1e-31 gb|ABN08240.1| Tetratricopeptide-like helical [Medicago truncatula] 128 2e-31 >gb|KVI09034.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 686 Score = 144 bits (362), Expect = 7e-37 Identities = 65/69 (94%), Positives = 68/69 (98%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRD+LRFHHF+D Sbjct: 618 HSEKLAVAFGILNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDSLRFHHFRD 677 Query: 183 GHCSCKDFW 209 GHCSCKDFW Sbjct: 678 GHCSCKDFW 686 >ref|XP_021973702.1| pentatricopeptide repeat-containing protein At1g20230-like [Helianthus annuus] Length = 686 Score = 138 bits (348), Expect = 6e-35 Identities = 63/69 (91%), Positives = 67/69 (97%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFGLLNL+GESSITVFKNLRICGDCHNAIKFMAKI GVTIVVRD+LRFHHF++ Sbjct: 618 HSEKLAVAFGLLNLSGESSITVFKNLRICGDCHNAIKFMAKISGVTIVVRDSLRFHHFRN 677 Query: 183 GHCSCKDFW 209 GHCSCKDFW Sbjct: 678 GHCSCKDFW 686 >ref|XP_021832308.1| putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Prunus avium] Length = 686 Score = 134 bits (337), Expect = 2e-33 Identities = 60/69 (86%), Positives = 65/69 (94%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNGES+I VFKNLRICGDCHNAIKFMAKIVGV I+VRD+LRFHHFKD Sbjct: 618 HSEKLAVAFGILNLNGESTIRVFKNLRICGDCHNAIKFMAKIVGVQIIVRDSLRFHHFKD 677 Query: 183 GHCSCKDFW 209 G CSC+DFW Sbjct: 678 GDCSCRDFW 686 >ref|XP_017241718.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Daucus carota subsp. sativus] gb|KZN02195.1| hypothetical protein DCAR_010949 [Daucus carota subsp. sativus] Length = 691 Score = 134 bits (336), Expect = 3e-33 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 HCE+LAVA+ +LNLNGESS+ VFKNLRICGDCHNAIKF+AKIVGV IVVRD+LRFHHFKD Sbjct: 623 HCERLAVAYAILNLNGESSVRVFKNLRICGDCHNAIKFIAKIVGVQIVVRDSLRFHHFKD 682 Query: 183 GHCSCKDFW 209 G CSCKDFW Sbjct: 683 GTCSCKDFW 691 >gb|OVA05194.1| Pentatricopeptide repeat [Macleaya cordata] Length = 686 Score = 132 bits (333), Expect = 7e-33 Identities = 59/69 (85%), Positives = 64/69 (92%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNGESSI VFKNLR+CGDCHNAIKFMAKIVGV I +RD+LRFHHFKD Sbjct: 618 HSEKLAVAFGVLNLNGESSIRVFKNLRVCGDCHNAIKFMAKIVGVQITLRDSLRFHHFKD 677 Query: 183 GHCSCKDFW 209 G CSC+DFW Sbjct: 678 GQCSCRDFW 686 >ref|XP_008226293.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Prunus mume] Length = 686 Score = 132 bits (333), Expect = 7e-33 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNGES+I VFKNLRICGDCHNAIKFMAKIVGV I+VRD+LRFHHFKD Sbjct: 618 HSEKLAVAFGILNLNGESTIRVFKNLRICGDCHNAIKFMAKIVGVQIIVRDSLRFHHFKD 677 Query: 183 GHCSCKDFW 209 G CSC++FW Sbjct: 678 GDCSCREFW 686 >ref|XP_007213606.1| putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Prunus persica] gb|ONI12073.1| hypothetical protein PRUPE_4G142900 [Prunus persica] Length = 686 Score = 132 bits (333), Expect = 7e-33 Identities = 59/69 (85%), Positives = 64/69 (92%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNGES+I VFKNLRICGDCHNAIKFM KIVGV I+VRD+LRFHHFKD Sbjct: 618 HSEKLAVAFGILNLNGESTIRVFKNLRICGDCHNAIKFMGKIVGVQIIVRDSLRFHHFKD 677 Query: 183 GHCSCKDFW 209 G CSC+DFW Sbjct: 678 GDCSCRDFW 686 >ref|XP_022879414.1| pentatricopeptide repeat-containing protein At1g20230-like [Olea europaea var. sylvestris] ref|XP_022879415.1| pentatricopeptide repeat-containing protein At1g20230-like [Olea europaea var. sylvestris] ref|XP_022879416.1| pentatricopeptide repeat-containing protein At1g20230-like [Olea europaea var. sylvestris] Length = 687 Score = 132 bits (333), Expect = 7e-33 Identities = 60/69 (86%), Positives = 64/69 (92%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNGESSI VFKNLRICGDCHN IKF+AKIVGV I+VRD+LRFHHFKD Sbjct: 619 HSEKLAVAFGILNLNGESSIRVFKNLRICGDCHNTIKFIAKIVGVQIIVRDSLRFHHFKD 678 Query: 183 GHCSCKDFW 209 G CSCKDFW Sbjct: 679 GLCSCKDFW 687 >ref|XP_002263297.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] ref|XP_010645112.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] ref|XP_003634818.2| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] ref|XP_010645113.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] ref|XP_010645114.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] ref|XP_019072459.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] emb|CBI24171.3| unnamed protein product, partial [Vitis vinifera] Length = 687 Score = 132 bits (333), Expect = 7e-33 Identities = 60/69 (86%), Positives = 65/69 (94%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNGESSI VFKNLRICGDCHNAIKFMAKIVGV I+VRD+LRFHHF+D Sbjct: 619 HSEKLAVAFGVLNLNGESSIRVFKNLRICGDCHNAIKFMAKIVGVKIIVRDSLRFHHFRD 678 Query: 183 GHCSCKDFW 209 G CSC+DFW Sbjct: 679 GLCSCQDFW 687 >ref|XP_008383032.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Malus domestica] Length = 686 Score = 132 bits (332), Expect = 9e-33 Identities = 59/69 (85%), Positives = 65/69 (94%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNGES+I VFKNLRICGDCHNAIKFMAKIVGV I+VRD+LRFHHFK+ Sbjct: 618 HSEKLAVAFGILNLNGESTIRVFKNLRICGDCHNAIKFMAKIVGVQIIVRDSLRFHHFKN 677 Query: 183 GHCSCKDFW 209 G CSC+DFW Sbjct: 678 GDCSCRDFW 686 >ref|XP_023729035.1| pentatricopeptide repeat-containing protein At1g20230-like [Lactuca sativa] gb|PLY77616.1| hypothetical protein LSAT_2X87200 [Lactuca sativa] Length = 686 Score = 131 bits (330), Expect = 2e-32 Identities = 59/69 (85%), Positives = 63/69 (91%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG++NL GES ITVFKNLRICGDCHNAIKFMAKIVGV IVVRD+LRFHHF+D Sbjct: 618 HSEKLAVAFGIMNLKGESEITVFKNLRICGDCHNAIKFMAKIVGVRIVVRDSLRFHHFRD 677 Query: 183 GHCSCKDFW 209 G CSC DFW Sbjct: 678 GFCSCNDFW 686 >ref|XP_018506254.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Pyrus x bretschneideri] Length = 686 Score = 131 bits (330), Expect = 2e-32 Identities = 58/69 (84%), Positives = 65/69 (94%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LN+NGES+I VFKNLRICGDCHNAIKFMAKIVGV I+VRD+LRFHHFK+ Sbjct: 618 HSEKLAVAFGILNMNGESTIRVFKNLRICGDCHNAIKFMAKIVGVQIIVRDSLRFHHFKN 677 Query: 183 GHCSCKDFW 209 G CSC+DFW Sbjct: 678 GDCSCRDFW 686 >gb|OTF97939.1| putative DYW domain-containing protein [Helianthus annuus] Length = 146 Score = 122 bits (305), Expect = 2e-32 Identities = 57/71 (80%), Positives = 63/71 (88%), Gaps = 2/71 (2%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIK--FMAKIVGVTIVVRDALRFHHF 176 H EKLAV+FGLLNL+GE+ +TVFKN RIC CHNAIK FMAKI GVTIVVRD+LRFHHF Sbjct: 76 HSEKLAVSFGLLNLSGETLLTVFKNFRICRYCHNAIKIKFMAKISGVTIVVRDSLRFHHF 135 Query: 177 KDGHCSCKDFW 209 +DGHCSCKDFW Sbjct: 136 RDGHCSCKDFW 146 >ref|XP_003622422.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AES78640.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 952 Score = 131 bits (329), Expect = 3e-32 Identities = 57/69 (82%), Positives = 66/69 (95%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNG+S+I VFKNLRICGDCHNAIK+M+ +VGVTIVVRD+LRFHHFK+ Sbjct: 884 HSEKLAVAFGILNLNGQSTIRVFKNLRICGDCHNAIKYMSNVVGVTIVVRDSLRFHHFKN 943 Query: 183 GHCSCKDFW 209 G+CSCKDFW Sbjct: 944 GNCSCKDFW 952 >gb|KHN27741.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 397 Score = 127 bits (319), Expect = 5e-32 Identities = 54/69 (78%), Positives = 66/69 (95%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNG+SSI VFKNLRICGDCHNAIK+++K+VGVTI+VRD+LRFHHF++ Sbjct: 329 HSEKLAVAFGILNLNGQSSIRVFKNLRICGDCHNAIKYVSKVVGVTIIVRDSLRFHHFRN 388 Query: 183 GHCSCKDFW 209 G+CSC+D W Sbjct: 389 GNCSCQDLW 397 >ref|XP_019185691.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Ipomoea nil] Length = 682 Score = 129 bits (325), Expect = 8e-32 Identities = 57/69 (82%), Positives = 63/69 (91%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNG S++TVFKNLRICGDCHN IKF+AK VGV I+VRD+LRFHHFKD Sbjct: 614 HSEKLAVAFGILNLNGASTLTVFKNLRICGDCHNVIKFIAKTVGVRIIVRDSLRFHHFKD 673 Query: 183 GHCSCKDFW 209 G CSCKDFW Sbjct: 674 GSCSCKDFW 682 >ref|XP_021758272.1| pentatricopeptide repeat-containing protein At1g20230-like [Chenopodium quinoa] Length = 686 Score = 129 bits (325), Expect = 8e-32 Identities = 58/69 (84%), Positives = 63/69 (91%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFGLLNLNGESSI VFKNLRICGDCHN IKF AK+VG+ I+VRD+LRFHHFKD Sbjct: 618 HSEKLAVAFGLLNLNGESSIRVFKNLRICGDCHNFIKFTAKVVGIQIIVRDSLRFHHFKD 677 Query: 183 GHCSCKDFW 209 G CSC+DFW Sbjct: 678 GLCSCQDFW 686 >ref|XP_021725463.1| pentatricopeptide repeat-containing protein At1g20230-like [Chenopodium quinoa] Length = 708 Score = 129 bits (325), Expect = 9e-32 Identities = 58/69 (84%), Positives = 63/69 (91%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFGLLNLNGESSI VFKNLRICGDCHN IKF AK+VG+ I+VRD+LRFHHFKD Sbjct: 640 HSEKLAVAFGLLNLNGESSIRVFKNLRICGDCHNFIKFTAKVVGIQIIVRDSLRFHHFKD 699 Query: 183 GHCSCKDFW 209 G CSC+DFW Sbjct: 700 GLCSCQDFW 708 >ref|XP_016440885.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Nicotiana tabacum] Length = 397 Score = 126 bits (316), Expect = 1e-31 Identities = 56/69 (81%), Positives = 63/69 (91%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H E+LAVAFG+LNL+G SSI VFKNLRICGDCHNAIK++AKIVGV I+VRD LRFHHFKD Sbjct: 329 HSERLAVAFGILNLDGASSIRVFKNLRICGDCHNAIKYLAKIVGVQIIVRDPLRFHHFKD 388 Query: 183 GHCSCKDFW 209 G CSC+DFW Sbjct: 389 GLCSCRDFW 397 >gb|ABN08240.1| Tetratricopeptide-like helical [Medicago truncatula] Length = 687 Score = 128 bits (322), Expect = 2e-31 Identities = 56/69 (81%), Positives = 65/69 (94%) Frame = +3 Query: 3 HCEKLAVAFGLLNLNGESSITVFKNLRICGDCHNAIKFMAKIVGVTIVVRDALRFHHFKD 182 H EKLAVAFG+LNLNG+S+I VFKNLRICGDCHNAIK+M+K+VGV IVVRD+LRFHHFK+ Sbjct: 619 HSEKLAVAFGILNLNGQSTIRVFKNLRICGDCHNAIKYMSKVVGVIIVVRDSLRFHHFKN 678 Query: 183 GHCSCKDFW 209 G+CSCKD W Sbjct: 679 GNCSCKDLW 687