BLASTX nr result
ID: Chrysanthemum21_contig00000162
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00000162 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG37043.1| putative proteinase inhibitor I13, potato inhibit... 53 6e-07 gb|KZN03234.1| hypothetical protein DCAR_011990 [Daucus carota s... 50 1e-05 >gb|OTG37043.1| putative proteinase inhibitor I13, potato inhibitor I [Helianthus annuus] Length = 70 Score = 53.1 bits (126), Expect = 6e-07 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 1 GSDTTTDFRCDRVWVRVNSRGIVVQVPAIG 90 G++ T DFRCDRVWVRVNS G+VVQ P+IG Sbjct: 41 GTNVTGDFRCDRVWVRVNSNGVVVQTPSIG 70 >gb|KZN03234.1| hypothetical protein DCAR_011990 [Daucus carota subsp. sativus] Length = 73 Score = 50.1 bits (118), Expect = 1e-05 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 1 GSDTTTDFRCDRVWVRVNSRGIVVQVPAIG 90 GS TT DFRCDRVWV VN+RGIVV P IG Sbjct: 44 GSPTTQDFRCDRVWVVVNNRGIVVSPPHIG 73