BLASTX nr result
ID: Chrysanthemum21_contig00000097
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00000097 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071139.1| F-box protein At1g70590 [Sesamum indicum] 59 5e-07 gb|EPS71841.1| hypothetical protein M569_02918, partial [Genlise... 58 8e-07 ref|XP_010248623.1| PREDICTED: F-box protein At1g70590 [Nelumbo ... 58 9e-07 ref|XP_021976043.1| F-box protein At1g70590 isoform X2 [Helianth... 58 1e-06 ref|XP_021976042.1| F-box protein At1g70590 isoform X1 [Helianth... 58 1e-06 ref|XP_004228556.1| PREDICTED: F-box protein At1g70590-like [Sol... 58 1e-06 gb|OVA20631.1| F-box domain [Macleaya cordata] 58 1e-06 ref|XP_015063624.1| PREDICTED: F-box protein At1g70590-like isof... 57 2e-06 ref|XP_016480513.1| PREDICTED: F-box protein At1g70590 [Nicotian... 57 2e-06 ref|XP_009605334.1| PREDICTED: F-box protein At1g70590 [Nicotian... 57 2e-06 ref|XP_012855448.1| PREDICTED: F-box protein At1g70590 [Erythran... 57 2e-06 ref|XP_015063615.1| PREDICTED: F-box protein At1g70590-like isof... 57 2e-06 ref|XP_016501273.1| PREDICTED: F-box protein At1g70590-like [Nic... 57 2e-06 gb|KVI05772.1| F-box domain, cyclin-like protein [Cynara cardunc... 57 2e-06 ref|XP_009764737.1| PREDICTED: F-box protein At1g70590 [Nicotian... 57 2e-06 gb|KZV17811.1| F-box protein [Dorcoceras hygrometricum] 57 2e-06 ref|XP_019233097.1| PREDICTED: F-box protein At1g70590 [Nicotian... 57 3e-06 ref|XP_006348506.1| PREDICTED: F-box protein At1g70590-like [Sol... 57 3e-06 ref|XP_022877097.1| F-box protein At1g70590 isoform X2 [Olea eur... 56 4e-06 ref|XP_022877094.1| F-box protein At1g70590 isoform X1 [Olea eur... 56 4e-06 >ref|XP_011071139.1| F-box protein At1g70590 [Sesamum indicum] Length = 341 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N++ LDS LKGA+RGSTLA VDAGL+Y ++G+ DEG+ Y+ Sbjct: 116 VKANLNKALDSFLKGAARGSTLAMVDAGLIYWEMGRKDEGIAWYR 160 >gb|EPS71841.1| hypothetical protein M569_02918, partial [Genlisea aurea] Length = 337 Score = 58.2 bits (139), Expect = 8e-07 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +KVN LDS LKGA+RGSTLA VDAGL+Y ++GK +EG+ Y+ Sbjct: 119 VKVNSSKALDSFLKGAARGSTLAMVDAGLIYWEMGKREEGIAWYR 163 >ref|XP_010248623.1| PREDICTED: F-box protein At1g70590 [Nelumbo nucifera] Length = 366 Score = 58.2 bits (139), Expect = 9e-07 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 ++ N+ LDS LKGA+RGSTLA VDAGL+Y +IGK EG+ +YK Sbjct: 142 VRPNLDKALDSFLKGAARGSTLAMVDAGLIYWEIGKKGEGIALYK 186 >ref|XP_021976043.1| F-box protein At1g70590 isoform X2 [Helianthus annuus] Length = 303 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/45 (57%), Positives = 37/45 (82%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +KV++ LDS LKGA+RGSTLA VDAGLVY ++G+ +EG+ +Y+ Sbjct: 124 VKVSMEKALDSFLKGAARGSTLAMVDAGLVYWEMGRKEEGVALYR 168 >ref|XP_021976042.1| F-box protein At1g70590 isoform X1 [Helianthus annuus] gb|OTG17081.1| putative F-box family protein [Helianthus annuus] Length = 349 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/45 (57%), Positives = 37/45 (82%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +KV++ LDS LKGA+RGSTLA VDAGLVY ++G+ +EG+ +Y+ Sbjct: 124 VKVSMEKALDSFLKGAARGSTLAMVDAGLVYWEMGRKEEGVALYR 168 >ref|XP_004228556.1| PREDICTED: F-box protein At1g70590-like [Solanum lycopersicum] Length = 357 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGL+Y ++GK +EG+ +Y+ Sbjct: 132 VKRNLSKALDSFLKGAARGSTLAMVDAGLLYWELGKREEGISLYR 176 >gb|OVA20631.1| F-box domain [Macleaya cordata] Length = 374 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 ++ N+ LDS L+GA+RGSTLA VDAGL+Y ++GK DEG+ YK Sbjct: 149 VRPNLQKALDSFLQGAARGSTLAMVDAGLIYWEMGKRDEGIAFYK 193 >ref|XP_015063624.1| PREDICTED: F-box protein At1g70590-like isoform X2 [Solanum pennellii] Length = 321 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGL+Y ++GK +EG+ +Y+ Sbjct: 131 VKRNLSKALDSFLKGAARGSTLAMVDAGLLYWEMGKREEGISLYR 175 >ref|XP_016480513.1| PREDICTED: F-box protein At1g70590 [Nicotiana tabacum] Length = 338 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGLVY ++G+ +EG+ +Y+ Sbjct: 113 VKSNLAKALDSFLKGAARGSTLAMVDAGLVYWEMGRREEGMSLYR 157 >ref|XP_009605334.1| PREDICTED: F-box protein At1g70590 [Nicotiana tomentosiformis] Length = 338 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGLVY ++G+ +EG+ +Y+ Sbjct: 113 VKSNLAKALDSFLKGAARGSTLAMVDAGLVYWEMGRREEGMSLYR 157 >ref|XP_012855448.1| PREDICTED: F-box protein At1g70590 [Erythranthe guttata] gb|EYU22526.1| hypothetical protein MIMGU_mgv1a009203mg [Erythranthe guttata] Length = 349 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGL+Y ++GK +EG+ Y+ Sbjct: 124 MKANLSKALDSFLKGAARGSTLAMVDAGLIYWEMGKREEGILWYR 168 >ref|XP_015063615.1| PREDICTED: F-box protein At1g70590-like isoform X1 [Solanum pennellii] Length = 356 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGL+Y ++GK +EG+ +Y+ Sbjct: 131 VKRNLSKALDSFLKGAARGSTLAMVDAGLLYWEMGKREEGISLYR 175 >ref|XP_016501273.1| PREDICTED: F-box protein At1g70590-like [Nicotiana tabacum] Length = 287 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGLVY ++G+ +EG+ +Y+ Sbjct: 113 VKPNLTKALDSFLKGAARGSTLAMVDAGLVYWEMGRREEGIALYR 157 >gb|KVI05772.1| F-box domain, cyclin-like protein [Cynara cardunculus var. scolymus] Length = 338 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ L+S LKGA+RGSTLA VDAGLVY ++GK +EG+ +Y+ Sbjct: 113 VKPNLEKALESFLKGAARGSTLAMVDAGLVYWEMGKKEEGVALYR 157 >ref|XP_009764737.1| PREDICTED: F-box protein At1g70590 [Nicotiana sylvestris] Length = 338 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGLVY ++G+ +EG+ +Y+ Sbjct: 113 VKPNLTKALDSFLKGAARGSTLAMVDAGLVYWEMGRREEGIALYR 157 >gb|KZV17811.1| F-box protein [Dorcoceras hygrometricum] Length = 342 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGL+Y ++G+ +EG+ Y+ Sbjct: 117 MKSNLSKALDSFLKGAARGSTLAMVDAGLIYWELGRREEGISWYR 161 >ref|XP_019233097.1| PREDICTED: F-box protein At1g70590 [Nicotiana attenuata] gb|OIT06742.1| f-box protein [Nicotiana attenuata] Length = 338 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGLVY ++G+ +EG+ +Y+ Sbjct: 113 VKPNLTKALDSFLKGAARGSTLALVDAGLVYWEMGRREEGIALYR 157 >ref|XP_006348506.1| PREDICTED: F-box protein At1g70590-like [Solanum tuberosum] Length = 356 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGSTLA VDAGL+Y ++GK +EG+ +Y+ Sbjct: 131 VKHNLSKALDSFLKGAARGSTLAMVDAGLLYWEMGKREEGIGLYR 175 >ref|XP_022877097.1| F-box protein At1g70590 isoform X2 [Olea europaea var. sylvestris] Length = 313 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGST+A VDAGL+Y ++GK +EG+ Y+ Sbjct: 119 VKPNLKKALDSFLKGAARGSTMAMVDAGLIYWEMGKKEEGIAWYR 163 >ref|XP_022877094.1| F-box protein At1g70590 isoform X1 [Olea europaea var. sylvestris] Length = 344 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -1 Query: 512 LKVNVHNPLDSLLKGASRGSTLAHVDAGLVYCKIGKNDEGLEMYK 378 +K N+ LDS LKGA+RGST+A VDAGL+Y ++GK +EG+ Y+ Sbjct: 119 VKPNLKKALDSFLKGAARGSTMAMVDAGLIYWEMGKKEEGIAWYR 163