BLASTX nr result
ID: Cheilocostus21_contig00066513
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00066513 (802 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018163951.1| Extracellular matrix protein [Colletotrichum... 58 2e-06 >ref|XP_018163951.1| Extracellular matrix protein [Colletotrichum higginsianum IMI 349063] emb|CCF40686.1| extracellular matrix protein [Colletotrichum higginsianum] gb|OBR15434.1| Extracellular matrix protein [Colletotrichum higginsianum IMI 349063] Length = 213 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/57 (56%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -1 Query: 802 LTLKNGDPNNLQXXXXXXXXXXXXSFTWTPPASLAANAQYAVSITDSTGT-NYSKQF 635 LTLKNG NNL SFTWTPP++LA + QYA+ ITD TGT NYS+QF Sbjct: 47 LTLKNGPSNNLNTVQVITSGQSGTSFTWTPPSTLATD-QYAIEITDGTGTPNYSEQF 102