BLASTX nr result
ID: Cheilocostus21_contig00066493
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00066493 (645 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003051594.1| hypothetical protein NECHADRAFT_102532 [[Nec... 65 2e-09 gb|KPM45042.1| hypothetical protein AK830_g1547 [Neonectria diti... 63 9e-09 gb|KFH44778.1| hypothetical protein ACRE_044110 [Acremonium chry... 63 9e-09 gb|KJZ80309.1| hypothetical protein HIM_00159 [Hirsutella minnes... 62 2e-08 gb|KYK55224.1| perilipin MPL1-like protein [Drechmeria coniospor... 62 2e-08 gb|EXK26764.1| hypothetical protein FOMG_16710 [Fusarium oxyspor... 60 8e-08 ref|XP_018256550.1| hypothetical protein FOXG_15915 [Fusarium ox... 60 9e-08 ref|XP_018244457.1| hypothetical protein FOXG_07131 [Fusarium ox... 59 3e-07 ref|XP_018177139.1| perilipin-like protein, Mpl1 [Purpureocilliu... 58 6e-07 gb|KDB18395.1| perilipin-like protein [Ustilaginoidea virens] >g... 58 8e-07 ref|XP_007723936.1| hypothetical protein A1O1_04857 [Capronia co... 57 1e-06 gb|OPB42188.1| CAP20 virulence factor [Trichoderma guizhouense] 57 1e-06 ref|XP_018664279.1| hypothetical protein TGAM01_02211 [Trichoder... 57 1e-06 gb|KKP00692.1| hypothetical protein THAR02_07206 [Trichoderma ha... 57 1e-06 ref|XP_013947102.1| hypothetical protein TRIATDRAFT_297698 [Tric... 57 1e-06 gb|ADH51542.1| perilipin MPL1-like protein [Metarhizium minus] 57 1e-06 ref|XP_007811945.1| perilipin-like protein [Metarhizium acridum ... 57 1e-06 ref|XP_007734897.1| hypothetical protein A1O3_06589 [Capronia ep... 57 2e-06 gb|PNP84601.1| hypothetical protein FNYG_02230 [Fusarium nygamai] 57 2e-06 gb|KPA40170.1| perilipin mpl1 [Fusarium langsethiae] 57 2e-06 >ref|XP_003051594.1| hypothetical protein NECHADRAFT_102532 [[Nectria] haematococca mpVI 77-13-4] gb|EEU45881.1| hypothetical protein NECHADRAFT_102532 [[Nectria] haematococca mpVI 77-13-4] Length = 182 Score = 64.7 bits (156), Expect = 2e-09 Identities = 26/48 (54%), Positives = 40/48 (83%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F+ Y+ E+KK+E+PG++ +GKA V TA ++S+ET+SW+ SFL+ KKAE Sbjct: 124 FEVYSSEYKKNEQPGLVAHGKAAVITALVVSNETLSWISSFLHQKKAE 171 >gb|KPM45042.1| hypothetical protein AK830_g1547 [Neonectria ditissima] Length = 184 Score = 63.2 bits (152), Expect = 9e-09 Identities = 25/47 (53%), Positives = 39/47 (82%) Frame = -3 Query: 640 KTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 + YT E+KK+E+ G++ +GKA V+T ++S+ET+SW+GSFL+ KKAE Sbjct: 127 QVYTSEYKKNEQAGLVAHGKAAVTTVLVVSNETLSWIGSFLHAKKAE 173 >gb|KFH44778.1| hypothetical protein ACRE_044110 [Acremonium chrysogenum ATCC 11550] Length = 185 Score = 63.2 bits (152), Expect = 9e-09 Identities = 27/48 (56%), Positives = 38/48 (79%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F Y+ E KK+E+ GV+ YGKA V+TA ++SSET++W+GSFL KKA+ Sbjct: 126 FHVYSSEAKKNEQEGVLGYGKAAVTTALVVSSETLNWLGSFLRAKKAD 173 >gb|KJZ80309.1| hypothetical protein HIM_00159 [Hirsutella minnesotensis 3608] Length = 184 Score = 62.4 bits (150), Expect = 2e-08 Identities = 26/49 (53%), Positives = 38/49 (77%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAEV 497 F+ Y+ E KK+E+PG++ GKA V+TA ++S+ET+SW+ S L KKAEV Sbjct: 126 FQVYSTEIKKNEQPGLVAQGKAAVTTALVVSNETLSWISSLLTAKKAEV 174 >gb|KYK55224.1| perilipin MPL1-like protein [Drechmeria coniospora] gb|ODA82156.1| hypothetical protein RJ55_00662 [Drechmeria coniospora] Length = 184 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/48 (56%), Positives = 39/48 (81%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F+ Y+ E KK+E+ G++ GKA VSTAF++S+ET+SW+ SFL+ KKAE Sbjct: 126 FQIYSSEVKKNEQQGLVGQGKAAVSTAFVVSTETLSWLSSFLSAKKAE 173 >gb|EXK26764.1| hypothetical protein FOMG_16710 [Fusarium oxysporum f. sp. melonis 26406] Length = 161 Score = 60.1 bits (144), Expect = 8e-08 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F+ Y E KK+E+ G++ +GKA V+T I+S+ET+SW+ SFL+ KKAE Sbjct: 103 FQVYNSELKKNEQAGLIAHGKAAVTTVIIVSNETLSWISSFLHRKKAE 150 >ref|XP_018256550.1| hypothetical protein FOXG_15915 [Fusarium oxysporum f. sp. lycopersici 4287] gb|KNB18505.1| hypothetical protein FOXG_15915 [Fusarium oxysporum f. sp. lycopersici 4287] Length = 168 Score = 60.1 bits (144), Expect = 9e-08 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F+ Y E KK+E+ G++ +GKA V+T I+S+ET+SW+ SFL+ KKAE Sbjct: 110 FQVYNSELKKNEQAGLIAHGKAAVTTVIIVSNETLSWISSFLHRKKAE 157 >ref|XP_018244457.1| hypothetical protein FOXG_07131 [Fusarium oxysporum f. sp. lycopersici 4287] gb|KNB06412.1| hypothetical protein FOXG_07131 [Fusarium oxysporum f. sp. lycopersici 4287] Length = 183 Score = 58.9 bits (141), Expect = 3e-07 Identities = 23/49 (46%), Positives = 38/49 (77%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAEV 497 F+ Y+ E KK+E+ G++ +GKA +T ++S+ET+SW+ SFL+ KKAE+ Sbjct: 125 FQVYSSEAKKNEQAGLVAHGKAATTTVLVVSNETLSWISSFLHQKKAEI 173 >ref|XP_018177139.1| perilipin-like protein, Mpl1 [Purpureocillium lilacinum] gb|OAQ80177.1| perilipin-like protein, Mpl1 [Purpureocillium lilacinum] gb|OAQ88420.1| perilipin-like protein, Mpl1 [Purpureocillium lilacinum] Length = 183 Score = 58.2 bits (139), Expect = 6e-07 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F+ Y+ E KK E+ G++ GKA VSTA ++S+ET+SW+ S L KKAE Sbjct: 125 FQVYSSEIKKAEQQGIVAQGKAAVSTALVVSNETLSWLSSLLTAKKAE 172 >gb|KDB18395.1| perilipin-like protein [Ustilaginoidea virens] dbj|GAO17486.1| hypothetical protein UVI_02000670 [Ustilaginoidea virens] Length = 183 Score = 57.8 bits (138), Expect = 8e-07 Identities = 25/48 (52%), Positives = 36/48 (75%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 ++ Y E KK+E+ G++ GKA VSTAF++S+ET+ W+ SFL KKAE Sbjct: 125 YEIYASEVKKNEQKGLVGQGKAAVSTAFVVSNETLGWLSSFLAAKKAE 172 >ref|XP_007723936.1| hypothetical protein A1O1_04857 [Capronia coronata CBS 617.96] gb|EXJ87930.1| hypothetical protein A1O1_04857 [Capronia coronata CBS 617.96] Length = 179 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAEVK 494 FKTY DE+KK GV+ GKA+++T+ I+SS+ + WV SFL KK E K Sbjct: 122 FKTYGDEYKKCGGDGVVAGGKAVITTSLILSSDVLKWVSSFLQAKKEEAK 171 >gb|OPB42188.1| CAP20 virulence factor [Trichoderma guizhouense] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 FK Y E KK E+ GV+ GKA VSTAF+IS+ET++W+ S++ KKA+ Sbjct: 125 FKIYASELKKLEQEGVVAQGKAAVSTAFVISNETLAWLSSWVAVKKAD 172 >ref|XP_018664279.1| hypothetical protein TGAM01_02211 [Trichoderma gamsii] gb|PNP47712.1| hypothetical protein TGAMA5MH_01536 [Trichoderma gamsii] gb|PON27868.1| hypothetical protein TGAM01_v203005 [Trichoderma gamsii] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F+ Y E KK E+ GV+ GKA VSTAF++S+ET++W+ SF+ KK E Sbjct: 125 FQVYASELKKLEQQGVVAQGKAAVSTAFVVSNETLAWLSSFVAVKKGE 172 >gb|KKP00692.1| hypothetical protein THAR02_07206 [Trichoderma harzianum] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 FK Y E KK E+ GV+ GKA VSTAF+IS+ET++W+ S++ KKA+ Sbjct: 125 FKIYASELKKLEQEGVVAQGKAAVSTAFVISNETLAWLSSWVAVKKAD 172 >ref|XP_013947102.1| hypothetical protein TRIATDRAFT_297698 [Trichoderma atroviride IMI 206040] gb|EHK48937.1| hypothetical protein TRIATDRAFT_297698 [Trichoderma atroviride IMI 206040] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F+ Y E KK E+ GV+ GKA VSTAF++S+ET++W+ SF+ KK E Sbjct: 125 FQVYASELKKLEQQGVVAQGKAAVSTAFVVSNETLAWLSSFVAVKKGE 172 >gb|ADH51542.1| perilipin MPL1-like protein [Metarhizium minus] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F Y E KK E+ G++ GKA VSTAF++S+ET+ W+ SFL KKAE Sbjct: 125 FDVYASEAKKIEQKGLVGQGKAAVSTAFVVSNETLGWLSSFLGAKKAE 172 >ref|XP_007811945.1| perilipin-like protein [Metarhizium acridum CQMa 102] gb|ADH51538.1| perilipin MPL1-like protein [Metarhizium acridum] gb|ADH51543.1| perilipin MPL1-like protein [Metarhizium minus] gb|EFY88396.1| perilipin-like protein [Metarhizium acridum CQMa 102] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F+ Y E KK E+ G++ GKA VSTAF++S+ET+ W+ SFL KKAE Sbjct: 125 FEVYASEAKKIEQKGLVGQGKAAVSTAFVVSNETLGWLSSFLAAKKAE 172 >ref|XP_007734897.1| hypothetical protein A1O3_06589 [Capronia epimyces CBS 606.96] gb|EXJ82774.1| hypothetical protein A1O3_06589 [Capronia epimyces CBS 606.96] Length = 180 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAEVK 494 FKTY DE+KK GV+ GKA+++T+ ++SS+ + WV SFL KK E K Sbjct: 122 FKTYGDEYKKCGGDGVVAGGKAVITTSLVLSSDVLKWVSSFLQAKKEEAK 171 >gb|PNP84601.1| hypothetical protein FNYG_02230 [Fusarium nygamai] Length = 182 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/48 (50%), Positives = 36/48 (75%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F+ Y E KK E+ G++ +GKA V+T ++S+ET+SW+ SFL+ KKAE Sbjct: 124 FQVYNSEIKKVEQGGLVAHGKAAVTTVLVVSNETLSWLSSFLHQKKAE 171 >gb|KPA40170.1| perilipin mpl1 [Fusarium langsethiae] Length = 182 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/48 (50%), Positives = 36/48 (75%) Frame = -3 Query: 643 FKTYTDEFKKDERPGVMTYGKALVSTAFIISSETISWVGSFLNTKKAE 500 F+ Y E KK E+ G++ +GKA V+T ++S+ET+SW+ SFL+ KKAE Sbjct: 124 FQVYNSEIKKVEQGGLVAHGKAAVTTVLVVSNETLSWLSSFLHQKKAE 171