BLASTX nr result
ID: Cheilocostus21_contig00066409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00066409 (653 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009648406.1| Microtubule associated protein [Verticillium... 144 7e-41 ref|XP_956248.1| autophagy protein 8 [Neurospora crassa OR74A] >... 140 3e-39 gb|KXX80680.1| Autophagy-related protein 8 [Madurella mycetomatis] 140 3e-39 emb|CRK32551.1| hypothetical protein BN1708_005811 [Verticillium... 144 5e-39 gb|OJJ06390.1| hypothetical protein ASPVEDRAFT_140090 [Aspergill... 139 8e-39 ref|XP_662735.1| hypothetical protein AN5131.2 [Aspergillus nidu... 139 8e-39 ref|XP_750493.1| autophagic death protein Aut7/IDI-7 [Aspergillu... 139 8e-39 ref|XP_002149194.1| autophagic death protein Aut7/IDI-7, putativ... 139 9e-39 emb|CCF31883.1| microtubule associated protein 1A/1B, partial [C... 137 1e-38 ref|XP_003666806.1| hypothetical protein MYCTH_2311835 [Thermoth... 138 2e-38 gb|APU52178.1| ATG8-3 [Dugesia japonica] 138 2e-38 emb|CRG83213.1| Autophagy-related protein 8 [Talaromyces islandi... 138 2e-38 dbj|GAD97317.1| autophagic death protein Aut7/IDI-7, putative [B... 138 2e-38 gb|KXH53253.1| autophagy protein 8 [Colletotrichum salicis] 138 3e-38 ref|XP_016640764.1| hypothetical protein SAPIO_CDS7870 [Scedospo... 138 3e-38 ref|XP_003657655.1| hypothetical protein THITE_2171560 [Thielavi... 138 3e-38 ref|XP_002484982.1| autophagic death protein Aut7/IDI-7, putativ... 137 3e-38 ref|XP_010763476.1| hypothetical protein PADG_08109 [Paracoccidi... 137 3e-38 ref|XP_002622874.1| gamma-aminobutyric acid receptor associated ... 137 3e-38 ref|XP_001909318.1| hypothetical protein [Podospora anserina S m... 137 4e-38 >ref|XP_009648406.1| Microtubule associated protein [Verticillium dahliae VdLs.17] gb|EGY17543.1| Microtubule associated protein [Verticillium dahliae VdLs.17] gb|AFC88092.1| autophagy protein [Verticillium dahliae] gb|AGH20051.1| autophagy protein 8 [Verticillium dahliae] emb|CRK21227.1| hypothetical protein BN1723_012291 [Verticillium longisporum] gb|PNH35440.1| hypothetical protein BJF96_g1241 [Verticillium dahliae] gb|PNH48405.1| hypothetical protein VD0004_g33 [Verticillium dahliae] gb|PNH49021.1| hypothetical protein VD0003_g8111 [Verticillium dahliae] gb|PNH59851.1| hypothetical protein VD0002_g7736 [Verticillium dahliae] gb|PNH77200.1| hypothetical protein VD0001_g444 [Verticillium dahliae] Length = 121 Score = 144 bits (364), Expect = 7e-41 Identities = 71/72 (98%), Positives = 71/72 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDCETA 216 SGENTFGDCETA Sbjct: 110 SGENTFGDCETA 121 >ref|XP_956248.1| autophagy protein 8 [Neurospora crassa OR74A] ref|XP_003350633.1| hypothetical protein SMAC_02305 [Sordaria macrospora k-hell] ref|XP_009851967.1| hypothetical protein NEUTE1DRAFT_117293 [Neurospora tetrasperma FGSC 2508] sp|Q8WZY7.1|ATG8_NEUCR RecName: Full=Autophagy-related protein 8; AltName: Full=Autophagy-related ubiquitin-like modifier atg8; Flags: Precursor emb|CAD21230.1| probable autophagy protein AUT7 [Neurospora crassa] gb|EAA27012.1| autophagy protein 8 [Neurospora crassa OR74A] gb|EGO56360.1| hypothetical protein NEUTE1DRAFT_117293 [Neurospora tetrasperma FGSC 2508] gb|EGZ70782.1| light chain 3 [Neurospora tetrasperma FGSC 2509] emb|CCC07296.1| unnamed protein product [Sordaria macrospora k-hell] gb|KHE87197.1| hypothetical protein GE21DRAFT_3442 [Neurospora crassa] Length = 121 Score = 140 bits (353), Expect = 3e-39 Identities = 70/72 (97%), Positives = 70/72 (97%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDCETA 216 SGENTFGD ETA Sbjct: 110 SGENTFGDFETA 121 >gb|KXX80680.1| Autophagy-related protein 8 [Madurella mycetomatis] Length = 121 Score = 140 bits (353), Expect = 3e-39 Identities = 70/72 (97%), Positives = 70/72 (97%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDCETA 216 SGENTFGD ETA Sbjct: 110 SGENTFGDFETA 121 >emb|CRK32551.1| hypothetical protein BN1708_005811 [Verticillium longisporum] Length = 270 Score = 144 bits (364), Expect = 5e-39 Identities = 71/72 (98%), Positives = 71/72 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 199 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 258 Query: 181 SGENTFGDCETA 216 SGENTFGDCETA Sbjct: 259 SGENTFGDCETA 270 >gb|OJJ06390.1| hypothetical protein ASPVEDRAFT_140090 [Aspergillus versicolor CBS 583.65] gb|OJJ56323.1| hypothetical protein ASPSYDRAFT_47609 [Aspergillus sydowii CBS 593.65] Length = 118 Score = 139 bits (350), Expect = 8e-39 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDC 207 SGENTFGDC Sbjct: 110 SGENTFGDC 118 >ref|XP_662735.1| hypothetical protein AN5131.2 [Aspergillus nidulans FGSC A4] sp|Q5B2U9.1|ATG8_EMENI RecName: Full=Autophagy-related protein 8; AltName: Full=Autophagy-related ubiquitin-like modifier atg8; Flags: Precursor gb|EAA62312.1| hypothetical protein AN5131.2 [Aspergillus nidulans FGSC A4] tpe|CBF80918.1| TPA: Autophagy-related protein 8 Precursor (Autophagy-related ubiquitin-like modifier atg8) [Source:UniProtKB/Swiss-Prot;Acc:Q5B2U9] [Aspergillus nidulans FGSC A4] emb|CEN61465.1| Putative Autophagy-related protein 8 [Aspergillus calidoustus] gb|OAX81709.1| hypothetical protein ACJ72_03953 [Emmonsia sp. CAC-2015a] Length = 118 Score = 139 bits (350), Expect = 8e-39 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDC 207 SGENTFGDC Sbjct: 110 SGENTFGDC 118 >ref|XP_750493.1| autophagic death protein Aut7/IDI-7 [Aspergillus fumigatus Af293] ref|XP_001209482.1| gamma-aminobutyric acid receptor associated protein [Aspergillus terreus NIH2624] ref|XP_001264924.1| autophagic death protein Aut7/IDI-7, putative [Aspergillus fischeri NRRL 181] ref|XP_001269418.1| autophagic death protein Aut7/IDI-7, putative [Aspergillus clavatus NRRL 1] ref|XP_001392077.1| autophagy-related protein 8 [Aspergillus niger CBS 513.88] ref|XP_002149193.1| autophagic death protein Aut7/IDI-7, putative [Talaromyces marneffei ATCC 18224] ref|XP_002149195.1| autophagic death protein Aut7/IDI-7, putative [Talaromyces marneffei ATCC 18224] ref|XP_002149196.1| autophagic death protein Aut7/IDI-7, putative [Talaromyces marneffei ATCC 18224] ref|XP_013323391.1| Autophagy-related protein 8 Precursor [Rasamsonia emersonii CBS 393.64] ref|XP_020119192.1| Autophagy-related protein 8 [Talaromyces atroroseus] ref|XP_022406114.1| hypothetical protein ASPGLDRAFT_41433 [Aspergillus glaucus CBS 516.65] sp|Q4WJ27.1|ATG8_ASPFU RecName: Full=Autophagy-related protein 8; AltName: Full=Autophagy-related ubiquitin-like modifier atg8; Flags: Precursor sp|Q0C804.1|ATG8_ASPTN RecName: Full=Autophagy-related protein 8; AltName: Full=Autophagy-related ubiquitin-like modifier atg8; Flags: Precursor sp|A1CQS1.1|ATG8_ASPCL RecName: Full=Autophagy-related protein 8; AltName: Full=Autophagy-related ubiquitin-like modifier atg8; Flags: Precursor sp|A2QPN1.1|ATG8_ASPNC RecName: Full=Autophagy-related protein 8; AltName: Full=Autophagy-related ubiquitin-like modifier atg8; Flags: Precursor sp|A1D3N4.1|ATG8_NEOFI RecName: Full=Autophagy-related protein 8; AltName: Full=Autophagy-related ubiquitin-like modifier atg8; Flags: Precursor gb|EAL88455.1| autophagic death protein Aut7/IDI-7, putative [Aspergillus fumigatus Af293] gb|EAU29629.1| gamma-aminobutyric acid receptor associated protein [Aspergillus terreus NIH2624] gb|EAW07992.1| autophagic death protein Aut7/IDI-7, putative [Aspergillus clavatus NRRL 1] gb|EAW23027.1| autophagic death protein Aut7/IDI-7, putative [Aspergillus fischeri NRRL 181] emb|CAK45131.1| unnamed protein product [Aspergillus niger] gb|EDP56077.1| autophagic death protein Aut7/IDI-7, putative [Aspergillus fumigatus A1163] gb|EEA23026.1| autophagic death protein Aut7/IDI-7, putative [Talaromyces marneffei ATCC 18224] gb|EEA23028.1| autophagic death protein Aut7/IDI-7, putative [Talaromyces marneffei ATCC 18224] gb|EEA23029.1| autophagic death protein Aut7/IDI-7, putative [Talaromyces marneffei ATCC 18224] gb|AEH41561.1| autophagic death protein Aut7/IDI-7 [Endocarpon pusillum] gb|EHA24357.1| hypothetical protein ASPNIDRAFT_209252 [Aspergillus niger ATCC 1015] dbj|GAA85598.1| autophagic death protein Aut7/IDI-7 [Aspergillus kawachii IFO 4308] gb|KEY80839.1| autophagic death protein Aut7/IDI 7 [Aspergillus fumigatus var. RP-2014] dbj|GAM40678.1| gamma-aminobutyric acid receptor-associated protein [Talaromyces cellulolyticus] gb|KKA16779.1| Autophagy-related protein 8 Precursor [Rasamsonia emersonii CBS 393.64] gb|KMK59908.1| autophagic death protein Aut7/IDI-7 [Aspergillus fumigatus Z5] dbj|GAO89492.1| autophagy-related protein 8 [Aspergillus udagawae] emb|CEJ54702.1| Putative Autophagy-related protein [Penicillium brasilianum] dbj|GAQ11062.1| autophagy-related protein 8 [Aspergillus lentulus] dbj|GAQ38728.1| autophagic death protein Aut7/IDI-7 [Aspergillus niger] gb|KUL85807.1| hypothetical protein ZTR_07378 [Talaromyces verruculosus] gb|ODM23620.1| Autophagy-related protein 8 [Aspergillus cristatus] gb|OJI82427.1| hypothetical protein ASPTUDRAFT_192670 [Aspergillus tubingensis CBS 134.48] gb|OJJ35718.1| hypothetical protein ASPWEDRAFT_40953 [Aspergillus wentii DTO 134E9] gb|OJJ73023.1| hypothetical protein ASPBRDRAFT_124729 [Aspergillus brasiliensis CBS 101740] gb|OJJ89452.1| hypothetical protein ASPGLDRAFT_41433 [Aspergillus glaucus CBS 516.65] gb|OJZ83536.1| hypothetical protein ASPFODRAFT_50283 [Aspergillus luchuensis CBS 106.47] gb|OKL59071.1| Autophagy-related protein 8 [Talaromyces atroroseus] gb|OOF96191.1| hypothetical protein ASPCADRAFT_207553 [Aspergillus carbonarius ITEM 5010] gb|OOQ84090.1| Autophagy-related protein 8 [Penicillium brasilianum] gb|OWW36742.1| Autophagy protein Atg8 ubiquitin like family protein [Aspergillus niger] gb|OXN07784.1| hypothetical protein CDV58_03595 [Aspergillus fumigatus] gb|OXN26424.1| hypothetical protein CDV57_04023 [Aspergillus fumigatus] gb|OXS08618.1| hypothetical protein CDV56_04680 [Aspergillus thermomutatus] gb|PKX94532.1| putative autophagic death protein Aut7/IDI-7 [Aspergillus novofumigatus IBT 16806] gb|PLB26283.1| putative autophagic death protein Aut7/IDI-7 [Aspergillus ochraceoroseus IBT 24754] gb|PLB39199.1| Autophagy-related protein 8 [Aspergillus candidus] gb|PLN77850.1| Autophagy-related protein 8 [Aspergillus taichungensis] emb|SPB47425.1| unnamed protein product [Aspergillus niger] Length = 118 Score = 139 bits (350), Expect = 8e-39 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDC 207 SGENTFGDC Sbjct: 110 SGENTFGDC 118 >ref|XP_002149194.1| autophagic death protein Aut7/IDI-7, putative [Talaromyces marneffei ATCC 18224] gb|EEA23027.1| autophagic death protein Aut7/IDI-7, putative [Talaromyces marneffei ATCC 18224] Length = 121 Score = 139 bits (350), Expect = 9e-39 Identities = 68/69 (98%), Positives = 68/69 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 53 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 112 Query: 181 SGENTFGDC 207 SGENTFGDC Sbjct: 113 SGENTFGDC 121 >emb|CCF31883.1| microtubule associated protein 1A/1B, partial [Colletotrichum higginsianum] Length = 86 Score = 137 bits (346), Expect = 1e-38 Identities = 69/72 (95%), Positives = 69/72 (95%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 15 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 74 Query: 181 SGENTFGDCETA 216 SGENTFG ETA Sbjct: 75 SGENTFGGFETA 86 >ref|XP_003666806.1| hypothetical protein MYCTH_2311835 [Thermothelomyces thermophila ATCC 42464] gb|AEO61561.1| hypothetical protein MYCTH_2311835 [Thermothelomyces thermophila ATCC 42464] Length = 121 Score = 138 bits (348), Expect = 2e-38 Identities = 69/72 (95%), Positives = 70/72 (97%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDCETA 216 SGENTFG+ ETA Sbjct: 110 SGENTFGNFETA 121 >gb|APU52178.1| ATG8-3 [Dugesia japonica] Length = 118 Score = 138 bits (347), Expect = 2e-38 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVP+DLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPSDLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDC 207 SGENTFGDC Sbjct: 110 SGENTFGDC 118 >emb|CRG83213.1| Autophagy-related protein 8 [Talaromyces islandicus] Length = 118 Score = 138 bits (347), Expect = 2e-38 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIY+EHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYDEHKDEDGFLYITY 109 Query: 181 SGENTFGDC 207 SGENTFGDC Sbjct: 110 SGENTFGDC 118 >dbj|GAD97317.1| autophagic death protein Aut7/IDI-7, putative [Byssochlamys spectabilis No. 5] Length = 118 Score = 138 bits (347), Expect = 2e-38 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIY+EHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYDEHKDEDGFLYITY 109 Query: 181 SGENTFGDC 207 SGENTFGDC Sbjct: 110 SGENTFGDC 118 >gb|KXH53253.1| autophagy protein 8 [Colletotrichum salicis] Length = 121 Score = 138 bits (347), Expect = 3e-38 Identities = 69/72 (95%), Positives = 69/72 (95%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDCETA 216 SGENTFGD E A Sbjct: 110 SGENTFGDFEMA 121 >ref|XP_016640764.1| hypothetical protein SAPIO_CDS7870 [Scedosporium apiospermum] gb|KEZ40965.1| hypothetical protein SAPIO_CDS7870 [Scedosporium apiospermum] gb|PKS13091.1| hypothetical protein jhhlp_000432 [Lomentospora prolificans] Length = 121 Score = 138 bits (347), Expect = 3e-38 Identities = 69/72 (95%), Positives = 69/72 (95%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIY EHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYAEHKDEDGFLYITY 109 Query: 181 SGENTFGDCETA 216 SGENTFGD ETA Sbjct: 110 SGENTFGDFETA 121 >ref|XP_003657655.1| hypothetical protein THITE_2171560 [Thielavia terrestris NRRL 8126] gb|AEO71319.1| hypothetical protein THITE_2171560 [Thielavia terrestris NRRL 8126] Length = 121 Score = 138 bits (347), Expect = 3e-38 Identities = 68/72 (94%), Positives = 70/72 (97%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD +LPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEILPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDCETA 216 SGENTFG+ ETA Sbjct: 110 SGENTFGNFETA 121 >ref|XP_002484982.1| autophagic death protein Aut7/IDI-7, putative [Talaromyces stipitatus ATCC 10500] gb|EED15029.1| autophagic death protein Aut7/IDI-7, putative [Talaromyces stipitatus ATCC 10500] gb|PLB45375.1| putative autophagic death protein Aut7/IDI-7 [Aspergillus steynii IBT 23096] Length = 118 Score = 137 bits (346), Expect = 3e-38 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDC 207 SGENTFG+C Sbjct: 110 SGENTFGEC 118 >ref|XP_010763476.1| hypothetical protein PADG_08109 [Paracoccidioides brasiliensis Pb18] gb|EEH43289.1| hypothetical protein PADG_08109 [Paracoccidioides brasiliensis Pb18] gb|EEH23137.2| hypothetical protein PABG_05348 [Paracoccidioides brasiliensis Pb03] gb|ODH20630.1| hypothetical protein ACO22_05830 [Paracoccidioides brasiliensis] gb|ODH45634.1| hypothetical protein GX48_08287 [Paracoccidioides brasiliensis] Length = 118 Score = 137 bits (346), Expect = 3e-38 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDC 207 SGENTFG+C Sbjct: 110 SGENTFGEC 118 >ref|XP_002622874.1| gamma-aminobutyric acid receptor associated protein [Blastomyces gilchristii SLH14081] ref|XP_002790126.1| Microtubule associated protein [Paracoccidioides lutzii Pb01] gb|EEH37594.1| Microtubule associated protein [Paracoccidioides lutzii Pb01] gb|EEQ90580.1| autophagy-like protein 8 [Blastomyces dermatitidis ER-3] gb|EGE81502.1| autophagy-like protein 8 [Blastomyces dermatitidis ATCC 18188] gb|EQL35532.1| autophagy-like protein 8 [Blastomyces dermatitidis ATCC 26199] gb|KKZ59177.1| autophagy-like protein 8 [Emmonsia crescens UAMH 3008] gb|KLJ07741.1| autophagy-like protein 8 [Emmonsia parva UAMH 139] gb|OAT11090.1| autophagy-like protein 8 [Blastomyces gilchristii SLH14081] gb|OJD10928.1| hypothetical protein ACJ73_09659 [Blastomyces percursus] gb|OJD20019.1| hypothetical protein AJ78_00035 [Emergomyces pasteuriana Ep9510] gb|PGG95625.1| hypothetical protein GX51_08193 [Emmonsia parva] gb|PGH30898.1| hypothetical protein GX50_06353 [Emmonsia crescens] Length = 118 Score = 137 bits (346), Expect = 3e-38 Identities = 67/69 (97%), Positives = 68/69 (98%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDC 207 SGENTFG+C Sbjct: 110 SGENTFGEC 118 >ref|XP_001909318.1| hypothetical protein [Podospora anserina S mat+] sp|Q8J282.1|ATG8_PODAS RecName: Full=Autophagy-related protein 8; AltName: Full=Autophagy-related ubiquitin-like modifier ATG8; AltName: Full=Induced during the incompatibility reaction protein 7; Flags: Precursor gb|AAN41258.1| IDI-7 [Podospora anserina] emb|CAP70450.1| unnamed protein product [Podospora anserina S mat+] emb|CDP27041.1| ATG8_PODAN [Podospora anserina S mat+] Length = 121 Score = 137 bits (346), Expect = 4e-38 Identities = 69/72 (95%), Positives = 69/72 (95%) Frame = +1 Query: 1 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDGVLPPTAALMSSIYEEHKDEDGFLYITY 180 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVD VLPPTAALMSSIYEEHKDEDGFLYITY Sbjct: 50 LVPADLTVGQFVYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITY 109 Query: 181 SGENTFGDCETA 216 SGENTFG ETA Sbjct: 110 SGENTFGGFETA 121