BLASTX nr result
ID: Cheilocostus21_contig00066367
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00066367 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHH84897.1| hypothetical protein CDD83_1212 [Cordyceps sp. RA... 74 4e-13 gb|KJZ76687.1| hypothetical protein HIM_04023 [Hirsutella minnes... 72 3e-12 ref|XP_018179678.1| hypothetical protein VFPFJ_05118 [Purpureoci... 70 1e-11 gb|OAQ84169.1| hypothetical protein VFPBJ_02937 [Purpureocillium... 70 1e-11 gb|PNY24652.1| Uncharacterized protein TCAP_05410 [Tolypocladium... 70 2e-11 gb|KXH44257.1| hypothetical protein CNYM01_07314 [Colletotrichum... 69 3e-11 emb|CCF44416.1| hypothetical protein CH063_13830 [Colletotrichum... 67 3e-11 gb|OLN95941.1| hypothetical protein CCHL11_05041 [Colletotrichum... 68 7e-11 gb|EQK98424.1| hypothetical protein OCS_05862 [Ophiocordyceps si... 67 1e-10 gb|KFH40620.1| hypothetical protein ACRE_086790 [Acremonium chry... 67 2e-10 gb|EXF78452.1| hypothetical protein CFIO01_11945 [Colletotrichum... 67 2e-10 ref|XP_022467517.1| hypothetical protein CORC01_14365 [Colletotr... 67 2e-10 ref|XP_006671161.1| hypothetical protein CCM_05954 [Cordyceps mi... 66 2e-10 ref|XP_018153537.1| hypothetical protein CH63R_11722 [Colletotri... 67 3e-10 gb|KXH28670.1| hypothetical protein CSIM01_08291, partial [Colle... 67 3e-10 gb|OHW92444.1| hypothetical protein CSPAE12_08811 [Colletotrichu... 67 3e-10 gb|KZL67093.1| hypothetical protein CT0861_04067 [Colletotrichum... 67 3e-10 gb|ATY58999.1| hypothetical protein A9K55_003319 [Cordyceps mili... 66 3e-10 gb|KZL88273.1| hypothetical protein CI238_01220, partial [Collet... 67 3e-10 ref|XP_007917966.1| hypothetical protein UCRPA7_7242 [Phaeoacrem... 64 2e-09 >gb|PHH84897.1| hypothetical protein CDD83_1212 [Cordyceps sp. RAO-2017] Length = 235 Score = 73.9 bits (180), Expect = 4e-13 Identities = 37/59 (62%), Positives = 43/59 (72%) Frame = +2 Query: 2 PSHRRRLFFTKFGDGHDKEPGAAPQPGVGRFLMPGRKRGQSGQGSELGSMERPRTATTA 178 PS R+R FF+KFGD D++ QP V RFLMPGRKRG S QGSELGSMERP+ + A Sbjct: 180 PSSRKRGFFSKFGDAPDRD-----QPAVARFLMPGRKRGHSAQGSELGSMERPKPSDEA 233 >gb|KJZ76687.1| hypothetical protein HIM_04023 [Hirsutella minnesotensis 3608] Length = 237 Score = 71.6 bits (174), Expect = 3e-12 Identities = 35/54 (64%), Positives = 42/54 (77%) Frame = +2 Query: 2 PSHRRRLFFTKFGDGHDKEPGAAPQPGVGRFLMPGRKRGQSGQGSELGSMERPR 163 P R+R FF+KFG+ DK+ + QPGV RFLM GRKRG SGQGSELGS+ERP+ Sbjct: 181 PQPRKRGFFSKFGESTDKD--STGQPGVSRFLMGGRKRGHSGQGSELGSLERPK 232 >ref|XP_018179678.1| hypothetical protein VFPFJ_05118 [Purpureocillium lilacinum] gb|OAQ90959.1| hypothetical protein VFPFJ_05118 [Purpureocillium lilacinum] Length = 237 Score = 70.1 bits (170), Expect = 1e-11 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGAAPQPGVGRFLMPGRKRGQSGQGSELGSMERPRTA 169 R+R FF+KFGD DK+ A V RFLMP RKRG SGQGSELG+M+RP+TA Sbjct: 182 RKRGFFSKFGDSQDKDGHLAEPSPVSRFLMPVRKRGHSGQGSELGAMDRPQTA 234 >gb|OAQ84169.1| hypothetical protein VFPBJ_02937 [Purpureocillium lilacinum] Length = 237 Score = 70.1 bits (170), Expect = 1e-11 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGAAPQPGVGRFLMPGRKRGQSGQGSELGSMERPRTA 169 R+R FF+KFGD DK+ A V RFLMP RKRG SGQGSELG+M+RP+TA Sbjct: 182 RKRGFFSKFGDSQDKDGHLAEPSPVSRFLMPVRKRGHSGQGSELGAMDRPQTA 234 >gb|PNY24652.1| Uncharacterized protein TCAP_05410 [Tolypocladium capitatum] Length = 233 Score = 69.7 bits (169), Expect = 2e-11 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGAAPQPGVGRFLMPGRKRGQSGQGSELGSMERPRT 166 R+R FF KFG+ DK+ + Q V RFLMPGRKRGQSGQG+ELGSM+RP+T Sbjct: 179 RKRGFFAKFGETQDKD--STDQQPVSRFLMPGRKRGQSGQGAELGSMDRPKT 228 >gb|KXH44257.1| hypothetical protein CNYM01_07314 [Colletotrichum nymphaeae SA-01] Length = 250 Score = 69.3 bits (168), Expect = 3e-11 Identities = 37/65 (56%), Positives = 46/65 (70%), Gaps = 2/65 (3%) Frame = +2 Query: 5 SHRRRLFFTKFGDGHDKEPGA-APQPGVGRFLM-PGRKRGQSGQGSELGSMERPRTATTA 178 S R R F++FGD KEP A +P GV RFL GRKRGQSGQGSELG++ERP++A + Sbjct: 185 SSRMRGLFSRFGDSDHKEPSANSPNSGVTRFLNGAGRKRGQSGQGSELGTIERPKSAASV 244 Query: 179 EVQEV 193 E E+ Sbjct: 245 ETTEI 249 >emb|CCF44416.1| hypothetical protein CH063_13830 [Colletotrichum higginsianum] Length = 131 Score = 66.6 bits (161), Expect = 3e-11 Identities = 36/63 (57%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGA-APQPGVGRFLM-PGRKRGQSGQGSELGSMERPRTATTAEV 184 R R F++FGD KEP A +P V RFL GRKRGQSGQGSELG++ERP++A + E Sbjct: 68 RMRGLFSRFGDSDHKEPSANSPNSSVTRFLSGAGRKRGQSGQGSELGTIERPKSAASVET 127 Query: 185 QEV 193 EV Sbjct: 128 TEV 130 >gb|OLN95941.1| hypothetical protein CCHL11_05041 [Colletotrichum chlorophyti] Length = 247 Score = 68.2 bits (165), Expect = 7e-11 Identities = 36/64 (56%), Positives = 46/64 (71%), Gaps = 2/64 (3%) Frame = +2 Query: 8 HRRRLFFTKFGDGHDKEPGAA-PQPGVGRFLM-PGRKRGQSGQGSELGSMERPRTATTAE 181 +R+R F++FGD KEP A+ P V RFL GRKRGQSGQGSELG++ERP++A + E Sbjct: 183 NRKRGLFSRFGDSDHKEPSASSPNSSVTRFLTGAGRKRGQSGQGSELGTIERPKSAASVE 242 Query: 182 VQEV 193 EV Sbjct: 243 TAEV 246 >gb|EQK98424.1| hypothetical protein OCS_05862 [Ophiocordyceps sinensis CO18] Length = 237 Score = 67.4 bits (163), Expect = 1e-10 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGAAPQPGVGRFLMPGRKRGQSGQGSELGSMERPRTATTA 178 R+R FF+KFG+ D++ + Q GV RFLM GRKRGQSGQGSELG +ERPR + A Sbjct: 182 RKRGFFSKFGEQPDRD--STGQAGVSRFLMHGRKRGQSGQGSELGQIERPRASVEA 235 >gb|KFH40620.1| hypothetical protein ACRE_086790 [Acremonium chrysogenum ATCC 11550] Length = 235 Score = 67.0 bits (162), Expect = 2e-10 Identities = 35/63 (55%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGAAPQPGVGRFLMPGRKRGQSGQGSELGSMER-PRTATTAEVQ 187 R+R FF+KFGDG +K+ A Q V RFL+PGRKR QSGQG+ELG ME+ PR T+E + Sbjct: 175 RKRGFFSKFGDGQEKD--AMNQGAVSRFLIPGRKRAQSGQGAELGHMEQHPRVVVTSEGR 232 Query: 188 EVA 196 + + Sbjct: 233 DAS 235 >gb|EXF78452.1| hypothetical protein CFIO01_11945 [Colletotrichum fioriniae PJ7] Length = 249 Score = 67.0 bits (162), Expect = 2e-10 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = +2 Query: 5 SHRRRLFFTKFGDGHDKEPGA-APQPGVGRFLM-PGRKRGQSGQGSELGSMERPRTATTA 178 S R R F++FGD KEP A +P V RFL GRKRGQSGQGSELG++ERP++A + Sbjct: 184 SSRMRGLFSRFGDSDHKEPSANSPNSSVTRFLNGAGRKRGQSGQGSELGTIERPKSAASV 243 Query: 179 EVQEV 193 E E+ Sbjct: 244 ETTEI 248 >ref|XP_022467517.1| hypothetical protein CORC01_14365 [Colletotrichum orchidophilum] gb|OHE90340.1| hypothetical protein CORC01_14365 [Colletotrichum orchidophilum] Length = 250 Score = 67.0 bits (162), Expect = 2e-10 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = +2 Query: 5 SHRRRLFFTKFGDGHDKEPGA-APQPGVGRFLM-PGRKRGQSGQGSELGSMERPRTATTA 178 S R R F++FGD KEP A +P V RFL GRKRGQSGQGSELG++ERP++A + Sbjct: 185 SSRMRGLFSRFGDSDHKEPSANSPNSSVTRFLNGAGRKRGQSGQGSELGTIERPKSAASV 244 Query: 179 EVQEV 193 E E+ Sbjct: 245 ETTEI 249 >ref|XP_006671161.1| hypothetical protein CCM_05954 [Cordyceps militaris CM01] gb|EGX91797.1| hypothetical protein CCM_05954 [Cordyceps militaris CM01] Length = 220 Score = 66.2 bits (160), Expect = 2e-10 Identities = 34/59 (57%), Positives = 42/59 (71%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGAAPQPGVGRFLMPGRKRGQSGQGSELGSMERPRTATTAEVQ 187 R+R FF K D DKE + P RFLM GRKRGQSGQG+ELGS++R RT+ T+EV+ Sbjct: 165 RKRGFFAKLTDSQDKESSPSTMP---RFLMGGRKRGQSGQGAELGSVDRRRTSVTSEVR 220 >ref|XP_018153537.1| hypothetical protein CH63R_11722 [Colletotrichum higginsianum IMI 349063] emb|CCF39626.1| hypothetical protein CH063_10406 [Colletotrichum higginsianum] gb|OBR05019.1| hypothetical protein CH63R_11722 [Colletotrichum higginsianum IMI 349063] Length = 248 Score = 66.6 bits (161), Expect = 3e-10 Identities = 36/63 (57%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGA-APQPGVGRFLM-PGRKRGQSGQGSELGSMERPRTATTAEV 184 R R F++FGD KEP A +P V RFL GRKRGQSGQGSELG++ERP++A + E Sbjct: 185 RMRGLFSRFGDSDHKEPSANSPNSSVTRFLSGAGRKRGQSGQGSELGTIERPKSAASVET 244 Query: 185 QEV 193 EV Sbjct: 245 TEV 247 >gb|KXH28670.1| hypothetical protein CSIM01_08291, partial [Colletotrichum simmondsii] Length = 284 Score = 67.0 bits (162), Expect = 3e-10 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = +2 Query: 5 SHRRRLFFTKFGDGHDKEPGA-APQPGVGRFLM-PGRKRGQSGQGSELGSMERPRTATTA 178 S R R F++FGD KEP A +P V RFL GRKRGQSGQGSELG++ERP++A + Sbjct: 219 SSRMRGLFSRFGDSDHKEPSANSPNSSVTRFLNGAGRKRGQSGQGSELGTIERPKSAASV 278 Query: 179 EVQEV 193 E E+ Sbjct: 279 ETTEI 283 >gb|OHW92444.1| hypothetical protein CSPAE12_08811 [Colletotrichum incanum] Length = 251 Score = 66.6 bits (161), Expect = 3e-10 Identities = 36/63 (57%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGA-APQPGVGRFLM-PGRKRGQSGQGSELGSMERPRTATTAEV 184 R R F++FGD KEP A +P V RFL GRKRGQSGQGSELG++ERP++A + E Sbjct: 188 RMRGLFSRFGDSDHKEPSANSPNSSVTRFLSGAGRKRGQSGQGSELGTIERPKSAASVET 247 Query: 185 QEV 193 EV Sbjct: 248 TEV 250 >gb|KZL67093.1| hypothetical protein CT0861_04067 [Colletotrichum tofieldiae] Length = 251 Score = 66.6 bits (161), Expect = 3e-10 Identities = 36/63 (57%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGA-APQPGVGRFLM-PGRKRGQSGQGSELGSMERPRTATTAEV 184 R R F++FGD KEP A +P V RFL GRKRGQSGQGSELG++ERP++A + E Sbjct: 188 RMRGLFSRFGDSDHKEPSANSPNSSVTRFLSGAGRKRGQSGQGSELGTIERPKSAASVET 247 Query: 185 QEV 193 EV Sbjct: 248 TEV 250 >gb|ATY58999.1| hypothetical protein A9K55_003319 [Cordyceps militaris] Length = 234 Score = 66.2 bits (160), Expect = 3e-10 Identities = 34/59 (57%), Positives = 42/59 (71%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGAAPQPGVGRFLMPGRKRGQSGQGSELGSMERPRTATTAEVQ 187 R+R FF K D DKE + P RFLM GRKRGQSGQG+ELGS++R RT+ T+EV+ Sbjct: 179 RKRGFFAKLTDSQDKESSPSTMP---RFLMGGRKRGQSGQGAELGSVDRRRTSVTSEVR 234 >gb|KZL88273.1| hypothetical protein CI238_01220, partial [Colletotrichum incanum] Length = 269 Score = 66.6 bits (161), Expect = 3e-10 Identities = 36/63 (57%), Positives = 44/63 (69%), Gaps = 2/63 (3%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGA-APQPGVGRFLM-PGRKRGQSGQGSELGSMERPRTATTAEV 184 R R F++FGD KEP A +P V RFL GRKRGQSGQGSELG++ERP++A + E Sbjct: 206 RMRGLFSRFGDSDHKEPSANSPNSSVTRFLSGAGRKRGQSGQGSELGTIERPKSAASVET 265 Query: 185 QEV 193 EV Sbjct: 266 TEV 268 >ref|XP_007917966.1| hypothetical protein UCRPA7_7242 [Phaeoacremonium minimum UCRPA7] gb|EON97303.1| hypothetical protein UCRPA7_7242 [Phaeoacremonium minimum UCRPA7] Length = 248 Score = 64.3 bits (155), Expect = 2e-09 Identities = 33/60 (55%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = +2 Query: 11 RRRLFFTKFGDGHDKEPGAAPQPGVGRF-LMPGRKRGQSGQGSELGSMERPRTATTAEVQ 187 ++R FF+KFGD H EP + P RF L+ GRKRGQSGQG+ELG+M+RP TA + E + Sbjct: 187 KKRGFFSKFGDSHP-EPTSTGSPTASRFSLISGRKRGQSGQGAELGAMDRPGTAGSVETE 245