BLASTX nr result
ID: Cheilocostus21_contig00066353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00066353 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY37816.1| hypothetical protein UCDDA912_g02161 [Diaporthe a... 59 5e-07 dbj|GAW22725.1| hypothetical protein ANO14919_122680 [fungal sp.... 58 7e-07 gb|KUI65032.1| Nipped-B-like protein B [Valsa mali] 58 7e-07 ref|XP_007832060.1| hypothetical protein PFICI_05288 [Pestalotio... 58 1e-06 ref|XP_009656856.1| hypothetical protein VDAG_09600 [Verticilliu... 55 1e-06 gb|KUI60352.1| Nipped-B-like protein B [Valsa mali var. pyri] 57 2e-06 emb|CRK48600.1| hypothetical protein BN1723_008093, partial [Ver... 56 2e-06 gb|ORY63449.1| hypothetical protein BCR38DRAFT_410373 [Pseudomas... 57 3e-06 gb|KJZ72096.1| hypothetical protein HIM_08551 [Hirsutella minnes... 56 3e-06 ref|XP_018181984.1| hypothetical protein VFPFJ_02426 [Purpureoci... 56 3e-06 emb|CRK16282.1| hypothetical protein BN1708_011718 [Verticillium... 56 3e-06 gb|EQB45305.1| hypothetical protein CGLO_15841 [Colletotrichum g... 55 6e-06 gb|ELQ43092.1| hypothetical protein OOU_Y34scaffold00174g57 [Mag... 55 6e-06 ref|XP_003712556.1| hypothetical protein MGG_05047 [Magnaporthe ... 55 6e-06 gb|ELQ68148.1| hypothetical protein OOW_P131scaffold00266g34 [Ma... 55 7e-06 gb|KXH42193.1| hypothetical protein CNYM01_13822 [Colletotrichum... 55 8e-06 gb|KXH25256.1| hypothetical protein CSIM01_04200 [Colletotrichum... 55 8e-06 gb|EXF74167.1| hypothetical protein CFIO01_07817 [Colletotrichum... 55 8e-06 dbj|GAP88883.1| putative nipped-B-like protein B [Rosellinia nec... 55 9e-06 >gb|KKY37816.1| hypothetical protein UCDDA912_g02161 [Diaporthe ampelina] Length = 736 Score = 58.5 bits (140), Expect = 5e-07 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 4/47 (8%) Frame = -3 Query: 351 RDGDRRTEDREKSKRAKK----ETLGAVGIGAAAASLLSVLTEAASG 223 RD DR ED + +RAKK ETLGAVGIG AAASLL VLTEAASG Sbjct: 689 RDRDREREDAREKRRAKKRVWGETLGAVGIGGAAASLLGVLTEAASG 735 >dbj|GAW22725.1| hypothetical protein ANO14919_122680 [fungal sp. No.14919] Length = 867 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -3 Query: 375 DPSSYRRHRDGDR-RTEDREKSKRAKKETLGAVGIGAAAASLLSVLTEAASG 223 DP + R D DR R DR K+A+ ETL AVGIG AAASLLSVLTEAA+G Sbjct: 815 DPYNRRSREDRDRDRDRDRGNRKKARSETLRAVGIGGAAASLLSVLTEAAAG 866 >gb|KUI65032.1| Nipped-B-like protein B [Valsa mali] Length = 880 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/53 (62%), Positives = 36/53 (67%) Frame = -3 Query: 378 HDPSSYRRHRDGDRRTEDREKSKRAKKETLGAVGIGAAAASLLSVLTEAASGF 220 H+P S+R RD D + R K ETLGAVGIG AAASLLSVLTEAA GF Sbjct: 829 HNPRSHR-DRDRDEARDRRRAKKSVWGETLGAVGIGGAAASLLSVLTEAAGGF 880 >ref|XP_007832060.1| hypothetical protein PFICI_05288 [Pestalotiopsis fici W106-1] gb|ETS83412.1| hypothetical protein PFICI_05288 [Pestalotiopsis fici W106-1] Length = 794 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = -3 Query: 357 RHRDGDRRTEDREKSKRAKKETLGAVGIGAAAASLLSVLTEAASGF 220 R+RD R++DR KR + ETL AVGIG AAASLL VL EAASGF Sbjct: 749 RYRDEGDRSDDRSIKKRVRSETLRAVGIGGAAASLLGVLAEAASGF 794 >ref|XP_009656856.1| hypothetical protein VDAG_09600 [Verticillium dahliae VdLs.17] gb|EGY19398.1| hypothetical protein VDAG_09600 [Verticillium dahliae VdLs.17] Length = 127 Score = 54.7 bits (130), Expect = 1e-06 Identities = 31/52 (59%), Positives = 37/52 (71%), Gaps = 3/52 (5%) Frame = -3 Query: 369 SSYRRHRDGDRRTEDREKSKRAKKE---TLGAVGIGAAAASLLSVLTEAASG 223 S+ RRHR+ D R E R+ R K+ TLGA+GIG AA SLLSVLTEAA+G Sbjct: 73 SASRRHRERDARGETRDPRDRKDKKKLGTLGAMGIGGAAGSLLSVLTEAANG 124 >gb|KUI60352.1| Nipped-B-like protein B [Valsa mali var. pyri] Length = 885 Score = 57.0 bits (136), Expect = 2e-06 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 4/51 (7%) Frame = -3 Query: 360 RRHRDGDRRTEDREKSKRAKK----ETLGAVGIGAAAASLLSVLTEAASGF 220 R HRD DR ++ +RAKK ETLGAVGIG AAASLLSVLTEAA GF Sbjct: 837 RSHRDRDR--DEARDRRRAKKSVWGETLGAVGIGGAAASLLSVLTEAAGGF 885 >emb|CRK48600.1| hypothetical protein BN1723_008093, partial [Verticillium longisporum] Length = 251 Score = 56.2 bits (134), Expect = 2e-06 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = -3 Query: 369 SSYRRHRDGDRRTEDREKSKRAKKE---TLGAVGIGAAAASLLSVLTEAASG 223 S+ RRHR+ D R E+R+ R K+ TLGA+GIG AA SLLSVLTEAA+G Sbjct: 197 SASRRHRERDARAENRDARDRKDKKKLGTLGAMGIGGAAGSLLSVLTEAANG 248 >gb|ORY63449.1| hypothetical protein BCR38DRAFT_410373 [Pseudomassariella vexata] Length = 793 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/47 (68%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -3 Query: 357 RHRDGDR--RTEDREKSKRAKKETLGAVGIGAAAASLLSVLTEAASG 223 R+RD DR +EDR K+A+ ETL AVGIG AAASLLSVLTEAA+G Sbjct: 746 RYRDKDRIETSEDRAARKKARGETLRAVGIGGAAASLLSVLTEAAAG 792 >gb|KJZ72096.1| hypothetical protein HIM_08551 [Hirsutella minnesotensis 3608] Length = 671 Score = 56.2 bits (134), Expect = 3e-06 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Frame = -3 Query: 381 GHDPSSYRRHRD--GDRRTEDREKSKRAKKETLGAVGIGAAAASLLSVLTEAASG 223 G D +R+HRD GDRR E R K+A ETLGAVGIG AAASL+ VL +AA G Sbjct: 617 GFDGDHHRQHRDRRGDRRDE-RSTKKKAWGETLGAVGIGGAAASLIGVLAQAAVG 670 >ref|XP_018181984.1| hypothetical protein VFPFJ_02426 [Purpureocillium lilacinum] gb|OAQ78983.1| hypothetical protein VFPBJ_07104 [Purpureocillium lilacinum] gb|OAQ93265.1| hypothetical protein VFPFJ_02426 [Purpureocillium lilacinum] Length = 676 Score = 56.2 bits (134), Expect = 3e-06 Identities = 33/58 (56%), Positives = 37/58 (63%), Gaps = 5/58 (8%) Frame = -3 Query: 381 GHDPSSYRRHRDGDR-----RTEDREKSKRAKKETLGAVGIGAAAASLLSVLTEAASG 223 G+D +R + GDR R EDR K+A ETLGAVGIG AAASLL VL EAA G Sbjct: 618 GYDGDHHRPYHRGDRERRGDRKEDRTMKKKAWGETLGAVGIGGAAASLLGVLAEAAVG 675 >emb|CRK16282.1| hypothetical protein BN1708_011718 [Verticillium longisporum] Length = 773 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = -3 Query: 369 SSYRRHRDGDRRTEDREKSKRAKKE---TLGAVGIGAAAASLLSVLTEAASG 223 S+ RRHR+ D R E+R+ R K+ TLGA+GIG AA SLLSVLTEAA+G Sbjct: 719 SASRRHRERDARAENRDARDRKDKKKLGTLGAMGIGGAAGSLLSVLTEAANG 770 >gb|EQB45305.1| hypothetical protein CGLO_15841 [Colletotrichum gloeosporioides Cg-14] Length = 644 Score = 55.5 bits (132), Expect = 6e-06 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 12/58 (20%) Frame = -3 Query: 363 YRRHRDGDR----------RTEDREK--SKRAKKETLGAVGIGAAAASLLSVLTEAAS 226 +R HRD DR RT +RE+ K+A ETLGAVGIG AAASLLSVLTEAAS Sbjct: 585 HREHRDRDRDHYPRRHHRDRTAERERRDKKKAWGETLGAVGIGGAAASLLSVLTEAAS 642 >gb|ELQ43092.1| hypothetical protein OOU_Y34scaffold00174g57 [Magnaporthe oryzae Y34] Length = 864 Score = 55.5 bits (132), Expect = 6e-06 Identities = 30/56 (53%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = -3 Query: 375 DPSSYRRHRDGDRRTEDREKSKRAKK----ETLGAVGIGAAAASLLSVLTEAASGF 220 D + H G + DR+ ++R KK +TLGA GIG AAASLLSVLTEAA+GF Sbjct: 809 DARRHGHHSQGAEPSRDRDSARREKKKAWGQTLGAAGIGGAAASLLSVLTEAATGF 864 >ref|XP_003712556.1| hypothetical protein MGG_05047 [Magnaporthe oryzae 70-15] gb|EHA52749.1| hypothetical protein MGG_05047 [Magnaporthe oryzae 70-15] Length = 882 Score = 55.5 bits (132), Expect = 6e-06 Identities = 30/56 (53%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = -3 Query: 375 DPSSYRRHRDGDRRTEDREKSKRAKK----ETLGAVGIGAAAASLLSVLTEAASGF 220 D + H G + DR+ ++R KK +TLGA GIG AAASLLSVLTEAA+GF Sbjct: 827 DARRHGHHSQGAEPSRDRDSARREKKKAWGQTLGAAGIGGAAASLLSVLTEAATGF 882 >gb|ELQ68148.1| hypothetical protein OOW_P131scaffold00266g34 [Magnaporthe oryzae P131] Length = 1023 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/56 (53%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = -3 Query: 375 DPSSYRRHRDGDRRTEDREKSKRAKK----ETLGAVGIGAAAASLLSVLTEAASGF 220 D + H G + DR+ ++R KK +TLGA GIG AAASLLSVLTEAA+GF Sbjct: 968 DARRHGHHSQGAEPSRDRDSARREKKKAWGQTLGAAGIGGAAASLLSVLTEAATGF 1023 >gb|KXH42193.1| hypothetical protein CNYM01_13822 [Colletotrichum nymphaeae SA-01] Length = 687 Score = 55.1 bits (131), Expect = 8e-06 Identities = 34/51 (66%), Positives = 36/51 (70%) Frame = -3 Query: 378 HDPSSYRRHRDGDRRTEDREKSKRAKKETLGAVGIGAAAASLLSVLTEAAS 226 H PS R HR+ R DR K+A ETLGAVGIG AAASLLSVLTEAAS Sbjct: 639 HYPS--RHHRE--RSDRDRRDKKKAWGETLGAVGIGGAAASLLSVLTEAAS 685 >gb|KXH25256.1| hypothetical protein CSIM01_04200 [Colletotrichum simmondsii] Length = 687 Score = 55.1 bits (131), Expect = 8e-06 Identities = 34/51 (66%), Positives = 36/51 (70%) Frame = -3 Query: 378 HDPSSYRRHRDGDRRTEDREKSKRAKKETLGAVGIGAAAASLLSVLTEAAS 226 H PS R HR+ R DR K+A ETLGAVGIG AAASLLSVLTEAAS Sbjct: 639 HYPS--RHHRE--RSDRDRRDKKKAWGETLGAVGIGGAAASLLSVLTEAAS 685 >gb|EXF74167.1| hypothetical protein CFIO01_07817 [Colletotrichum fioriniae PJ7] Length = 687 Score = 55.1 bits (131), Expect = 8e-06 Identities = 34/51 (66%), Positives = 36/51 (70%) Frame = -3 Query: 378 HDPSSYRRHRDGDRRTEDREKSKRAKKETLGAVGIGAAAASLLSVLTEAAS 226 H PS R HR+ R DR K+A ETLGAVGIG AAASLLSVLTEAAS Sbjct: 639 HYPS--RHHRE--RSDRDRRDKKKAWGETLGAVGIGGAAASLLSVLTEAAS 685 >dbj|GAP88883.1| putative nipped-B-like protein B [Rosellinia necatrix] Length = 888 Score = 55.1 bits (131), Expect = 9e-06 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -3 Query: 357 RHRDGDR-RTEDREKSKRAKKETLGAVGIGAAAASLLSVLTEAASG 223 R RD DR R DR K+++ ETL AVGIG AAASLLSVLTEAA+G Sbjct: 842 RDRDRDRDRDRDRGSRKKSRSETLRAVGIGGAAASLLSVLTEAAAG 887