BLASTX nr result
ID: Cheilocostus21_contig00066310
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00066310 (544 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNR53412.1| hypothetical protein PHYPA_007087 [Physcomitrella... 77 9e-16 gb|PNR40893.1| hypothetical protein PHYPA_018296 [Physcomitrella... 63 4e-10 gb|PNR59845.1| hypothetical protein PHYPA_002637 [Physcomitrella... 56 3e-07 >gb|PNR53412.1| hypothetical protein PHYPA_007087 [Physcomitrella patens] Length = 59 Score = 77.4 bits (189), Expect = 9e-16 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 391 KTLAEPTFGGLRNYNSENDCNCGPNCNCADCDCHK 287 ++LAEPTFGGLRNYN+ENDC CGP C+CADCDCHK Sbjct: 25 RSLAEPTFGGLRNYNAENDCKCGPGCSCADCDCHK 59 >gb|PNR40893.1| hypothetical protein PHYPA_018296 [Physcomitrella patens] Length = 60 Score = 62.8 bits (151), Expect = 4e-10 Identities = 24/35 (68%), Positives = 27/35 (77%), Gaps = 2/35 (5%) Frame = -1 Query: 385 LAEPTFGGLRNYNSENDCNCGPNCNC--ADCDCHK 287 +AEP FGG RNYN+EN C CGP+C C DCDCHK Sbjct: 26 MAEPVFGGFRNYNTENGCKCGPDCKCDTCDCDCHK 60 >gb|PNR59845.1| hypothetical protein PHYPA_002637 [Physcomitrella patens] Length = 92 Score = 56.2 bits (134), Expect = 3e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 361 LRNYNSENDCNCGPNCNCADCDCHK 287 L N+N+ENDC CGPNCNCADC CHK Sbjct: 68 LVNFNAENDCKCGPNCNCADCACHK 92