BLASTX nr result
ID: Cheilocostus21_contig00066295
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00066295 (615 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY35503.1| hypothetical protein UCDDA912_g04553 [Diaporthe a... 61 3e-08 gb|POS71544.1| hypothetical protein DHEL01_v210058 [Diaporthe he... 60 3e-07 gb|EQB46679.1| hypothetical protein CGLO_14254 [Colletotrichum g... 57 4e-07 gb|ELA37899.1| hypothetical protein CGGC5_2822 [Colletotrichum g... 56 1e-06 ref|XP_013949641.1| hypothetical protein TRIVIDRAFT_217229 [Tric... 56 1e-06 gb|KZL67032.1| hypothetical protein CI238_04706 [Colletotrichum ... 55 2e-06 ref|XP_022469948.1| hypothetical protein CORC01_11930 [Colletotr... 54 7e-06 gb|EXF82261.1| hypothetical protein CFIO01_03195 [Colletotrichum... 54 7e-06 >gb|KKY35503.1| hypothetical protein UCDDA912_g04553 [Diaporthe ampelina] Length = 150 Score = 60.8 bits (146), Expect = 3e-08 Identities = 35/59 (59%), Positives = 39/59 (66%) Frame = +1 Query: 157 PWDKPFTETNLRHQEMFSTFTMTFGRQRRGSSGAWSYESGVSPLTSRQCSVVDLSAEPP 333 P ++P TE NLRHQEM TFTM FGR RR S GA S SG+SP +CS VD SA P Sbjct: 63 PSERPLTEQNLRHQEMLGTFTMKFGRSRRFSRGARSSFSGISP----RCS-VDSSAGTP 116 >gb|POS71544.1| hypothetical protein DHEL01_v210058 [Diaporthe helianthi] Length = 234 Score = 59.7 bits (143), Expect = 3e-07 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = +1 Query: 157 PWDKPFTETNLRHQEMFSTFTMTFGRQRRGSSGAWSYESGVSPLTSRQCSVVDLS 321 P ++P TE NLRHQEM TFTM FGR RR S GA S SG+SP +CS+ L+ Sbjct: 132 PSERPLTEQNLRHQEMLGTFTMKFGRSRRFSRGARSSFSGISP----RCSIDSLA 182 >gb|EQB46679.1| hypothetical protein CGLO_14254 [Colletotrichum gloeosporioides Cg-14] Length = 137 Score = 57.4 bits (137), Expect = 4e-07 Identities = 32/72 (44%), Positives = 45/72 (62%), Gaps = 1/72 (1%) Frame = +1 Query: 97 LPWGRERRDRKKKSLDSCYGPWDKPFTETNLRHQEMFSTFTMTFGRQRRGSSGAWSYES- 273 L W + +KK++ P ++PF+ETNLRHQE+ + FT+TFG+++ SY S Sbjct: 39 LRWFSKDEKPEKKAVKEKPDPRERPFSETNLRHQEILNGFTLTFGKRQPSRDTRSSYYSI 98 Query: 274 GVSPLTSRQCSV 309 GVSP TSR SV Sbjct: 99 GVSPGTSRHNSV 110 >gb|ELA37899.1| hypothetical protein CGGC5_2822 [Colletotrichum gloeosporioides Nara gc5] Length = 137 Score = 56.2 bits (134), Expect = 1e-06 Identities = 32/72 (44%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = +1 Query: 97 LPWGRERRDRKKKSLDSCYGPWDKPFTETNLRHQEMFSTFTMTFGRQRRGSSGAWSYES- 273 L W + +KK+ P ++PF+ETNLRHQE+ + FT+TFG++ SY S Sbjct: 39 LRWFSKDEKPEKKAAKEKPDPRERPFSETNLRHQEILNGFTLTFGKRHPSRDTRSSYYSI 98 Query: 274 GVSPLTSRQCSV 309 GVSP TSR SV Sbjct: 99 GVSPGTSRHNSV 110 >ref|XP_013949641.1| hypothetical protein TRIVIDRAFT_217229 [Trichoderma virens Gv29-8] gb|EHK15440.1| hypothetical protein TRIVIDRAFT_217229 [Trichoderma virens Gv29-8] Length = 140 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/67 (43%), Positives = 39/67 (58%) Frame = +1 Query: 109 RERRDRKKKSLDSCYGPWDKPFTETNLRHQEMFSTFTMTFGRQRRGSSGAWSYESGVSPL 288 +E +DRKK + P +KP TE NL+HQEM S FTMTFG ++ G+SP Sbjct: 67 KEEKDRKKTKGRTWKHPSEKPLTEQNLKHQEMLSHFTMTFGASDPTQVQELDFD-GISPC 125 Query: 289 TSRQCSV 309 +R CS+ Sbjct: 126 CTRNCSI 132 >gb|KZL67032.1| hypothetical protein CI238_04706 [Colletotrichum incanum] gb|OHW95022.1| hypothetical protein CSPAE12_06292 [Colletotrichum incanum] Length = 141 Score = 55.5 bits (132), Expect = 2e-06 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = +1 Query: 109 RERRDRKKKSLDSCYGPWDKPFTETNLRHQEMFSTFTMTFGRQRRGSS---GAWSYESGV 279 +E + +KK D P ++PF ETNLRHQE+ + FT+TFG+ +R S + Y V Sbjct: 44 KEEKPKKKPMKDEKSDPRERPFNETNLRHQEILNGFTLTFGKGQRQMSRDQRSSYYSINV 103 Query: 280 SPLTSRQCSV 309 SP TSR SV Sbjct: 104 SPGTSRHNSV 113 >ref|XP_022469948.1| hypothetical protein CORC01_11930 [Colletotrichum orchidophilum] gb|OHE92780.1| hypothetical protein CORC01_11930 [Colletotrichum orchidophilum] Length = 141 Score = 54.3 bits (129), Expect = 7e-06 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 4/71 (5%) Frame = +1 Query: 109 RERRDRKKKSL-DSCYGPWDKPFTETNLRHQEMFSTFTMTFGR-QRRGSSGAWS--YESG 276 +E + +KK ++ + P ++PF ETNLRHQE+ + FTMTFG+ QR+ S A S Y Sbjct: 43 KEEKPKKKTAIKEKEADPRERPFNETNLRHQEILNGFTMTFGKGQRQMSRDARSSYYSIN 102 Query: 277 VSPLTSRQCSV 309 VSP TSR SV Sbjct: 103 VSPGTSRHNSV 113 >gb|EXF82261.1| hypothetical protein CFIO01_03195 [Colletotrichum fioriniae PJ7] gb|KXH59924.1| hypothetical protein CSAL01_02509 [Colletotrichum salicis] Length = 141 Score = 54.3 bits (129), Expect = 7e-06 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 4/71 (5%) Frame = +1 Query: 109 RERRDRKKKSL-DSCYGPWDKPFTETNLRHQEMFSTFTMTFGR-QRRGSSGAWS--YESG 276 +E + +KK ++ + P ++PF ETNLRHQE+ + FTMTFG+ QR+ S A S Y Sbjct: 43 KEEKPKKKTAIKEKEADPRERPFNETNLRHQEILNGFTMTFGKGQRQMSRDARSSYYSIN 102 Query: 277 VSPLTSRQCSV 309 VSP TSR SV Sbjct: 103 VSPGTSRHNSV 113