BLASTX nr result
ID: Cheilocostus21_contig00066173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00066173 (547 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CRK32076.1| hypothetical protein BN1708_018913, partial [Ver... 115 8e-31 gb|KXJ94192.1| 40S ribosomal protein S27, partial [Microdochium ... 115 2e-30 gb|EYB22000.1| hypothetical protein FG05_06407, partial [Fusariu... 115 2e-30 gb|PFH58860.1| hypothetical protein XA68_13108 [Ophiocordyceps u... 115 2e-30 gb|OTA62736.1| hypothetical protein K449DRAFT_405491 [Hypoxylon ... 115 2e-30 ref|XP_001906915.1| hypothetical protein [Podospora anserina S m... 115 2e-30 gb|OIW31109.1| 40S ribosomal protein S27 [Coniochaeta ligniaria ... 115 2e-30 gb|ODA76492.1| hypothetical protein RJ55_07762 [Drechmeria conio... 115 2e-30 ref|XP_003007631.1| 40S ribosomal protein S27 [Verticillium alfa... 115 2e-30 ref|XP_965758.1| 40S ribosomal protein S27 [Neurospora crassa OR... 115 2e-30 gb|KUI63965.1| 40S ribosomal protein S27 [Valsa mali] 115 2e-30 gb|AAY85811.1| 40S ribosomal protein S27 [Chaetomium globosum] 115 2e-30 dbj|GAP86602.1| putative 40S ribosomal protein S27 [Rosellinia n... 115 2e-30 gb|KIL92468.1| 40s ribosomal protein s27 [Fusarium avenaceum] 115 2e-30 gb|KFA61883.1| hypothetical protein S40285_06558 [Stachybotrys c... 115 2e-30 ref|XP_016639096.1| hypothetical protein SAPIO_CDS9977 [Scedospo... 115 2e-30 gb|KEY73150.1| hypothetical protein S7711_04898 [Stachybotrys ch... 115 2e-30 ref|XP_003352468.1| 40S ribosomal protein S27 [Sordaria macrospo... 115 2e-30 gb|EMR70947.1| putative 40s ribosomal protein s27 protein [Eutyp... 115 2e-30 ref|XP_009228069.1| 40S ribosomal protein S27 [Gaeumannomyces tr... 115 2e-30 >emb|CRK32076.1| hypothetical protein BN1708_018913, partial [Verticillium longisporum] emb|CRK44797.1| hypothetical protein BN1723_019548, partial [Verticillium longisporum] Length = 60 Score = 115 bits (289), Expect = 8e-31 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 9 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 60 >gb|KXJ94192.1| 40S ribosomal protein S27, partial [Microdochium bolleyi] Length = 81 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 30 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 81 >gb|EYB22000.1| hypothetical protein FG05_06407, partial [Fusarium graminearum] Length = 81 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 30 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 81 >gb|PFH58860.1| hypothetical protein XA68_13108 [Ophiocordyceps unilateralis] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >gb|OTA62736.1| hypothetical protein K449DRAFT_405491 [Hypoxylon sp. EC38] gb|OTA93185.1| hypothetical protein M434DRAFT_308144 [Hypoxylon sp. CO27-5] gb|OTB00019.1| hypothetical protein M426DRAFT_76051 [Hypoxylon sp. CI-4A] gb|OTB15385.1| hypothetical protein K445DRAFT_117747 [Daldinia sp. EC12] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_001906915.1| hypothetical protein [Podospora anserina S mat+] emb|CAP67586.1| unnamed protein product [Podospora anserina S mat+] emb|CDP23847.1| Putative cytosolic 40S ribosomal protein Rps27 [Podospora anserina S mat+] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >gb|OIW31109.1| 40S ribosomal protein S27 [Coniochaeta ligniaria NRRL 30616] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >gb|ODA76492.1| hypothetical protein RJ55_07762 [Drechmeria coniospora] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_003007631.1| 40S ribosomal protein S27 [Verticillium alfalfae VaMs.102] ref|XP_003720862.1| 40S ribosomal protein S27 [Magnaporthe oryzae 70-15] ref|XP_007813220.1| 40S ribosomal protein S27 [Metarhizium acridum CQMa 102] ref|XP_007915666.1| putative 40s ribosomal protein s27 protein [Phaeoacremonium minimum UCRPA7] ref|XP_009263703.1| hypothetical protein FPSE_12311 [Fusarium pseudograminearum CS3096] ref|XP_009656057.1| 40S ribosomal protein S27 [Verticillium dahliae VdLs.17] ref|XP_011325071.1| hypothetical protein FGSG_06407 [Fusarium graminearum PH-1] ref|XP_014542958.1| Ribosomal protein S27e, partial [Metarhizium brunneum ARSEF 3297] ref|XP_018244779.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. lycopersici 4287] ref|XP_018752013.1| 40S ribosomal protein S27 [Fusarium verticillioides 7600] ref|XP_022284052.1| ribosomal protein S27e [Pochonia chlamydosporia 170] ref|XP_023427212.1| probable 40S ribosomal protein S27-2 [Fusarium fujikuroi IMI 58289] gb|EAQ71223.1| hypothetical protein MGCH7_ch7g630 [Magnaporthe oryzae 70-15] gb|EEY15710.1| 40S ribosomal protein S27 [Verticillium alfalfae VaMs.102] gb|ADD84571.1| ribosomal protein S27 [Magnaporthe oryzae] gb|EFY87091.1| 40S ribosomal protein S27 [Metarhizium acridum CQMa 102] gb|EGU86636.1| hypothetical protein FOXB_02857 [Fusarium oxysporum Fo5176] gb|EGY19717.1| 40S ribosomal protein S27 [Verticillium dahliae VdLs.17] gb|EHA46119.1| 40S ribosomal protein S27 [Magnaporthe oryzae 70-15] gb|EKJ67496.1| hypothetical protein FPSE_12311 [Fusarium pseudograminearum CS3096] gb|ELQ43471.1| 40S ribosomal protein S27 [Magnaporthe oryzae Y34] gb|ELQ64579.1| 40S ribosomal protein S27 [Magnaporthe oryzae P131] gb|EMT60274.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. cubense race 4] gb|ENH65676.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. cubense race 1] gb|EON99622.1| putative 40s ribosomal protein s27 protein [Phaeoacremonium minimum UCRPA7] gb|EQK99502.1| Ribosomal protein S27e [Ophiocordyceps sinensis CO18] emb|CCT65131.1| probable 40S ribosomal protein S27-2 [Fusarium fujikuroi IMI 58289] gb|ESU12495.1| hypothetical protein FGSG_06407 [Fusarium graminearum PH-1] gb|EWG45822.1| 40S ribosomal protein S27 [Fusarium verticillioides 7600] gb|EWY96188.1| 40S ribosomal protein S27 [Fusarium oxysporum FOSC 3-a] gb|EWZ41994.1| 40S ribosomal protein S27 [Fusarium oxysporum Fo47] gb|EXA00908.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. lycopersici MN25] gb|EXA47733.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. pisi HDV247] gb|EXK31575.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. melonis 26406] gb|EXK80265.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. raphani 54005] gb|EXL59591.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gb|EXL87479.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gb|EXL95692.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gb|EXM25220.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. vasinfectum 25433] gb|EXU99053.1| ribosomal protein S27 [Metarhizium robertsii] gb|KFG88018.1| 40S ribosomal protein S27 [Metarhizium anisopliae] gb|KID66013.1| Ribosomal protein S27e, partial [Metarhizium anisopliae ARSEF 549] gb|KID73763.1| Ribosomal protein S27e, partial [Metarhizium brunneum ARSEF 3297] gb|KID85207.1| Ribosomal protein S27e [Metarhizium guizhouense ARSEF 977] gb|KJZ74868.1| 40S ribosomal protein S27 [Hirsutella minnesotensis 3608] gb|KKY35760.1| putative 40s ribosomal protein s27 [Diaporthe ampelina] gb|KLO95628.1| putative 40S ribosomal protein S27-2 [Fusarium fujikuroi] gb|KLP12124.1| putative 40S ribosomal protein S27-2 [Fusarium fujikuroi] gb|KLP16655.1| putative 40S ribosomal protein S27-2 [Fusarium fujikuroi] gb|KNB06734.1| 40S ribosomal protein S27 [Fusarium oxysporum f. sp. lycopersici 4287] emb|CRK23381.1| hypothetical protein BN1708_003653 [Verticillium longisporum] emb|CRK19311.1| hypothetical protein BN1723_002525 [Verticillium longisporum] gb|KPA42494.1| 40s ribosomal protein s27 [Fusarium langsethiae] gb|OBS22207.1| hypothetical protein FPOA_08543 [Fusarium poae] emb|CZR36868.1| probable 40S ribosomal protein S27-2 [Fusarium proliferatum ET1] emb|CVL00163.1| probable 40S ribosomal protein S27-2 [Fusarium mangiferae] gb|ORY55303.1| ribosomal protein S27-domain-containing protein [Pseudomassariella vexata] gb|OAQ59896.2| ribosomal protein S27e [Pochonia chlamydosporia 170] gb|PCD43879.1| hypothetical protein AU210_002967 [Fusarium oxysporum f. sp. radicis-cucumerinum] gb|PHH61204.1| hypothetical protein CDD81_685 [Ophiocordyceps australis] gb|PHH69628.1| hypothetical protein CDD82_7627 [Ophiocordyceps australis] gb|PHH92383.1| hypothetical protein CDD83_7665 [Cordyceps sp. RAO-2017] gb|PNH32918.1| hypothetical protein BJF96_g3731 [Verticillium dahliae] gb|PNH40283.1| hypothetical protein VD0004_g6703 [Verticillium dahliae] gb|PNH50202.1| hypothetical protein VD0003_g6981 [Verticillium dahliae] gb|PNH62757.1| hypothetical protein VD0002_g5389 [Verticillium dahliae] gb|PNH71824.1| hypothetical protein VD0001_g5706 [Verticillium dahliae] gb|POS76733.1| 40S ribosomal protein S27 [Diaporthe helianthi] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_965758.1| 40S ribosomal protein S27 [Neurospora crassa OR74A] ref|XP_009857184.1| 40S ribosomal protein S27 [Neurospora tetrasperma FGSC 2508] ref|XP_008098992.1| ribosomal protein S27 [Colletotrichum graminicola M1.001] sp|Q7RVN2.1|RS27_NEUCR RecName: Full=40S ribosomal protein S27; AltName: Full=Cytoplasmic ribosomal protein 6 gb|EAA36522.1| 40S ribosomal protein S27 [Neurospora crassa OR74A] gb|EFQ34972.1| ribosomal protein S27 [Colletotrichum graminicola M1.001] gb|EGO53594.1| 40S ribosomal protein S27 [Neurospora tetrasperma FGSC 2508] gb|PKS09462.1| hypothetical protein jhhlp_004078 [Lomentospora prolificans] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >gb|KUI63965.1| 40S ribosomal protein S27 [Valsa mali] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >gb|AAY85811.1| 40S ribosomal protein S27 [Chaetomium globosum] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >dbj|GAP86602.1| putative 40S ribosomal protein S27 [Rosellinia necatrix] dbj|GAW16441.1| hypothetical protein ANO14919_058690 [fungal sp. No.14919] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >gb|KIL92468.1| 40s ribosomal protein s27 [Fusarium avenaceum] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >gb|KFA61883.1| hypothetical protein S40285_06558 [Stachybotrys chlorohalonata IBT 40285] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_016639096.1| hypothetical protein SAPIO_CDS9977 [Scedosporium apiospermum] gb|KEZ39297.1| hypothetical protein SAPIO_CDS9977 [Scedosporium apiospermum] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >gb|KEY73150.1| hypothetical protein S7711_04898 [Stachybotrys chartarum IBT 7711] gb|KFA54027.1| hypothetical protein S40293_01752 [Stachybotrys chartarum IBT 40293] gb|KFA80791.1| hypothetical protein S40288_04787 [Stachybotrys chartarum IBT 40288] gb|KND87808.1| 40S ribosomal protein S27 [Tolypocladium ophioglossoides CBS 100239] gb|KUI59891.1| 40S ribosomal protein S27 [Valsa mali var. pyri] gb|POR33709.1| Uncharacterized protein TPAR_06107 [Tolypocladium paradoxum] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_003352468.1| 40S ribosomal protein S27 [Sordaria macrospora k-hell] ref|XP_003652018.1| 40S ribosomal protein S27 THITE_56072 [Thielavia terrestris NRRL 8126] ref|XP_022480324.1| 40S ribosomal protein S27 [Colletotrichum orchidophilum] gb|AEO65682.1| hypothetical protein THITE_56072 [Thielavia terrestris NRRL 8126] emb|CCC07735.1| unnamed protein product [Sordaria macrospora k-hell] gb|ELA30514.1| 40s ribosomal protein s27 [Colletotrichum gloeosporioides Nara gc5] gb|ENH86002.1| 40s ribosomal protein s27 [Colletotrichum orbiculare MAFF 240422] gb|KFH47466.1| 40S ribosomal protein-like protein [Acremonium chrysogenum ATCC 11550] gb|KXH60439.1| 40S ribosomal protein S27 [Colletotrichum salicis] gb|KXX76679.1| hypothetical protein MMYC01_206515 [Madurella mycetomatis] gb|OHF03187.1| 40S ribosomal protein S27 [Colletotrichum orchidophilum] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >gb|EMR70947.1| putative 40s ribosomal protein s27 protein [Eutypa lata UCREL1] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_009228069.1| 40S ribosomal protein S27 [Gaeumannomyces tritici R3-111a-1] gb|EJT70891.1| 40S ribosomal protein S27 [Gaeumannomyces tritici R3-111a-1] Length = 82 Score = 115 bits (289), Expect = 2e-30 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +2 Query: 2 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 157 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK Sbjct: 31 FFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK 82