BLASTX nr result
ID: Cheilocostus21_contig00065915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00065915 (606 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019178412.1| PREDICTED: uncharacterized protein LOC109173... 30 8e-06 >ref|XP_019178412.1| PREDICTED: uncharacterized protein LOC109173591 [Ipomoea nil] Length = 273 Score = 30.0 bits (66), Expect(4) = 8e-06 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 86 KVVLRILEYLNGAPWKAILYKMNGH 12 + V +IL YL GAP + I+Y+ +GH Sbjct: 156 RAVEQILNYLKGAPGRGIVYQNHGH 180 Score = 29.6 bits (65), Expect(4) = 8e-06 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 172 NYLIITKPYIFYGVIVISQLCRIP 101 NYLI+T+P I Y V V+SQ P Sbjct: 127 NYLIVTRPDITYSVSVVSQFMASP 150 Score = 28.1 bits (61), Expect(4) = 8e-06 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 345 LFLSQRKYIIDFL*ENGIL 289 +FLSQRKY++D L E G L Sbjct: 73 IFLSQRKYVLDLLTETGKL 91 Score = 27.7 bits (60), Expect(4) = 8e-06 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -3 Query: 541 HSTFIQCTSSSTFILAIYVAEILLIGSNKQHIFYVK 434 HS F + + + +L +YV +I++IGS+ I +K Sbjct: 8 HSAFYKHSKTGIILLVVYVDDIVIIGSDTAGIASLK 43