BLASTX nr result
ID: Cheilocostus21_contig00065378
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00065378 (471 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP63600.1| Retrovirus-related Pol polyprotein from transposo... 44 1e-08 ref|XP_018813453.1| PREDICTED: uncharacterized protein LOC108985... 44 3e-08 gb|KOM54435.1| hypothetical protein LR48_Vigan10g032700 [Vigna a... 44 3e-08 dbj|BAT73483.1| hypothetical protein VIGAN_01097100, partial [Vi... 43 5e-08 gb|KOM56592.1| hypothetical protein LR48_Vigan10g248400 [Vigna a... 44 7e-08 gb|KOM38790.1| hypothetical protein LR48_Vigan03g217200 [Vigna a... 44 8e-08 gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposo... 42 1e-07 emb|CAN81716.1| hypothetical protein VITISV_032903 [Vitis vinifera] 45 1e-07 gb|KYP44825.1| Retrovirus-related Pol polyprotein from transposo... 42 2e-07 gb|KOM58362.1| hypothetical protein LR48_Vigan11g139600 [Vigna a... 42 2e-07 dbj|GAU27876.1| hypothetical protein TSUD_159700 [Trifolium subt... 43 3e-07 emb|CAN72710.1| hypothetical protein VITISV_018096 [Vitis vinifera] 42 4e-07 emb|CAN60317.1| hypothetical protein VITISV_002851 [Vitis vinifera] 44 4e-07 gb|ABI34329.1| Integrase core domain containing protein [Solanum... 42 5e-07 gb|KYP63559.1| Retrovirus-related Pol polyprotein from transposo... 44 5e-07 ref|XP_020218720.1| uncharacterized protein LOC109801952 isoform... 44 5e-07 ref|XP_014518773.2| uncharacterized protein LOC106776001 isoform... 43 5e-07 gb|ABI34342.1| Polyprotein, putative [Solanum demissum] 42 6e-07 emb|CAN79305.1| hypothetical protein VITISV_036286 [Vitis vinifera] 43 7e-07 dbj|BAT82265.1| hypothetical protein VIGAN_03224900 [Vigna angul... 41 7e-07 >gb|KYP63600.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 334 Score = 43.9 bits (102), Expect(2) = 1e-08 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LS 244 SR KGY C+ R+ Y+S DVTF+E P+FY +T+ LS Sbjct: 279 SRLQKGYKCYSPKTRKFYMSADVTFFEQTPFFYCTTHDSLS 319 Score = 42.7 bits (99), Expect(2) = 1e-08 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 ++PR+FGC C+V++ G+DKL+ AI+ VFLG Sbjct: 245 VSPRVFGCTCFVHNVSPGLDKLSARAIKCVFLG 277 >ref|XP_018813453.1| PREDICTED: uncharacterized protein LOC108985564 [Juglans regia] Length = 201 Score = 43.5 bits (101), Expect(2) = 3e-08 Identities = 19/39 (48%), Positives = 26/39 (66%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLGSHEPKK 351 L P+IFG +CYV+SFG G DKL P + + F+G +K Sbjct: 24 LPPKIFGYVCYVHSFGPGFDKLDPRSTKCFFVGYSRTQK 62 Score = 42.0 bits (97), Expect(2) = 3e-08 Identities = 16/33 (48%), Positives = 25/33 (75%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFY 268 SRT KGY C+ + RR+++S +VTF+E + YF+ Sbjct: 58 SRTQKGYRCYSHVLRRYFMSANVTFFESISYFF 90 >gb|KOM54435.1| hypothetical protein LR48_Vigan10g032700 [Vigna angularis] Length = 160 Score = 43.5 bits (101), Expect(2) = 3e-08 Identities = 17/33 (51%), Positives = 27/33 (81%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 ++PR+FGC+C+V++ G+DKL+ AI+ VFLG Sbjct: 48 VSPRVFGCMCFVHNVSPGLDKLSAKAIKCVFLG 80 Score = 42.0 bits (97), Expect(2) = 3e-08 Identities = 23/52 (44%), Positives = 31/52 (59%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LSKVLQLFYLLRC 211 SR KGY C+ +R+Y+S DVTF+E P F+ S+ S V Q+F L C Sbjct: 82 SRLQKGYKCYSPSTKRYYMSADVTFFEDTP-FFPSSMEDRSSVQQMFPLPTC 132 >dbj|BAT73483.1| hypothetical protein VIGAN_01097100, partial [Vigna angularis var. angularis] Length = 198 Score = 43.1 bits (100), Expect(2) = 5e-08 Identities = 16/31 (51%), Positives = 25/31 (80%) Frame = -2 Query: 461 PRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 PR+FGC+C+V++ G+DKL+ A++ VFLG Sbjct: 26 PRVFGCVCFVHNMSPGLDKLSARALKCVFLG 56 Score = 41.6 bits (96), Expect(2) = 5e-08 Identities = 17/35 (48%), Positives = 25/35 (71%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRS 262 SR KGY C+ +++Y+SV+VTF+E PYF+ S Sbjct: 58 SRLQKGYQCYSPETKKYYMSVNVTFFEQTPYFFPS 92 >gb|KOM56592.1| hypothetical protein LR48_Vigan10g248400 [Vigna angularis] Length = 120 Score = 44.3 bits (103), Expect(2) = 7e-08 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 + PR+FGC C+V++ G+DKL+P +I+ VFLG Sbjct: 24 IPPRVFGCTCFVHNVSPGLDKLSPKSIKCVFLG 56 Score = 40.0 bits (92), Expect(2) = 7e-08 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRS 262 SR KGY C+ RR+Y+S DVTF+E P+F S Sbjct: 58 SRIQKGYRCYSPSTRRYYMSSDVTFFEDTPFFLSS 92 >gb|KOM38790.1| hypothetical protein LR48_Vigan03g217200 [Vigna angularis] Length = 1119 Score = 44.3 bits (103), Expect(2) = 8e-08 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 + PR+FGC C+V++ G+DKL+P +I+ VFLG Sbjct: 420 IPPRVFGCTCFVHNVSPGLDKLSPKSIKCVFLG 452 Score = 39.7 bits (91), Expect(2) = 8e-08 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRS 262 SR KGY C+ RR+Y+S DVTF+E P+F S Sbjct: 454 SRIQKGYRCYSPSTRRNYMSSDVTFFEDTPFFLSS 488 >gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 1353 Score = 42.0 bits (97), Expect(2) = 1e-07 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRST 259 SR KGY CF RR+Y+S DVTF+E P++ ST Sbjct: 682 SRLQKGYKCFSPSTRRYYMSADVTFFEDTPFYPSST 717 Score = 41.2 bits (95), Expect(2) = 1e-07 Identities = 16/31 (51%), Positives = 24/31 (77%) Frame = -2 Query: 461 PRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 P++FGC C+V++ G+DKL+ AI+ VFLG Sbjct: 650 PKVFGCTCFVHNLSPGLDKLSARAIKCVFLG 680 >emb|CAN81716.1| hypothetical protein VITISV_032903 [Vitis vinifera] Length = 1170 Score = 44.7 bits (104), Expect(2) = 1e-07 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 6/63 (9%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LSKVLQLFYL------LRCHL 205 SR KGY C+ R+++S+DVTF+E P+F S +S+VL L Y+ L C L Sbjct: 539 SRLQKGYRCYSPDTHRYFLSIDVTFFEDSPFFSSSESLPISEVLPLPYISPPSNALSCPL 598 Query: 204 RVH 196 +V+ Sbjct: 599 QVY 601 Score = 38.5 bits (88), Expect(2) = 1e-07 Identities = 16/33 (48%), Positives = 23/33 (69%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 L PR+FGC C+V++ G DKL+ A + +FLG Sbjct: 505 LPPRVFGCTCFVHTLTPGQDKLSAKATKCIFLG 537 >gb|KYP44825.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1371 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 17/33 (51%), Positives = 25/33 (75%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 ++PR+FGC C+V+ G+DKL+ AI+ VFLG Sbjct: 661 VSPRVFGCTCFVHDVSPGLDKLSARAIKCVFLG 693 Score = 40.4 bits (93), Expect(2) = 2e-07 Identities = 24/63 (38%), Positives = 35/63 (55%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LSKVLQLFYLLRCHLRVHLPC 187 SR KGY C+ ++ Y+S DVTF+E P+F ST +S +Q + HL + P Sbjct: 695 SRLQKGYKCYSPKTKKFYMSADVTFFEHTPFFLSSTNDSVS--IQQVLPVSSHLSI--PL 750 Query: 186 RPL 178 +PL Sbjct: 751 QPL 753 >gb|KOM58362.1| hypothetical protein LR48_Vigan11g139600 [Vigna angularis] Length = 492 Score = 42.4 bits (98), Expect(2) = 2e-07 Identities = 16/33 (48%), Positives = 27/33 (81%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 ++PR+FGC+C+V++ G+DK++ AI+ VFLG Sbjct: 129 VSPRVFGCMCFVHNVSLGLDKVSAKAIKCVFLG 161 Score = 40.4 bits (93), Expect(2) = 2e-07 Identities = 22/52 (42%), Positives = 30/52 (57%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LSKVLQLFYLLRC 211 SR KGY C+ +R+Y+S DVTF+E P F+ S+ S Q+F L C Sbjct: 163 SRLQKGYKCYSPSTKRYYMSADVTFFEDTP-FFPSSMEGRSSTQQMFPLPTC 213 >dbj|GAU27876.1| hypothetical protein TSUD_159700 [Trifolium subterraneum] Length = 1257 Score = 42.7 bits (99), Expect(2) = 3e-07 Identities = 17/39 (43%), Positives = 28/39 (71%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLGSHEPKK 351 L+PR+FG C+V++ G+DKL+ +++ VFLG H +K Sbjct: 493 LSPRVFGSTCFVHNLSPGLDKLSARSLKCVFLGYHRSQK 531 Score = 39.3 bits (90), Expect(2) = 3e-07 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 363 RT*KGYWCFDSIQRRHYISVDVTFYELVPYF 271 R+ KGY C+ +R+ +S DVTF+E +PYF Sbjct: 528 RSQKGYRCYSPTLKRYLVSADVTFFESIPYF 558 >emb|CAN72710.1| hypothetical protein VITISV_018096 [Vitis vinifera] Length = 1110 Score = 42.0 bits (97), Expect(2) = 4e-07 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LSKVLQLFYL 220 SR KGY C+ R+++S DVTF+E P+F S +S+VL L Y+ Sbjct: 527 SRLQKGYRCYSPDTHRYFLSADVTFFEDSPFFSSSESLPISEVLPLPYI 575 Score = 39.7 bits (91), Expect(2) = 4e-07 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 L PRIFGC C+V++ G DKL+ A + +FLG Sbjct: 493 LPPRIFGCTCFVHTLTHGQDKLSAKATKCIFLG 525 >emb|CAN60317.1| hypothetical protein VITISV_002851 [Vitis vinifera] Length = 975 Score = 43.5 bits (101), Expect(2) = 4e-07 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 6/63 (9%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LSKVLQLFYL------LRCHL 205 SR KGY C+ R ++SVDVTF+E P+F S +S+VL L Y+ L C L Sbjct: 653 SRLQKGYRCYSPDTHRCFLSVDVTFFEDSPFFLSSESLPISEVLPLPYMSPPSDALSCPL 712 Query: 204 RVH 196 +V+ Sbjct: 713 QVY 715 Score = 38.1 bits (87), Expect(2) = 4e-07 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -2 Query: 461 PRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 PR+FGC C+V++ G DKL+ A + +FLG Sbjct: 621 PRVFGCTCFVHTLTLGQDKLSATATKCIFLG 651 >gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum] Length = 1775 Score = 42.0 bits (97), Expect(2) = 5e-07 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = -2 Query: 470 PLTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLGSHEPKK 351 P+ PR+FG C+V++ G DKL P A++ VFLG +K Sbjct: 705 PIPPRVFGSTCFVHNLAPGKDKLAPRALKCVFLGYSRVQK 744 Score = 39.3 bits (90), Expect(2) = 5e-07 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LSKVLQL 229 SR KGY C+ R+ +S DVTF+E PY+ S + +S VL + Sbjct: 740 SRVQKGYRCYSHDLHRYLMSADVTFFESQPYYTSSNHPDVSMVLPI 785 >gb|KYP63559.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1378 Score = 44.3 bits (103), Expect(2) = 5e-07 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 ++PR+FGC+C+V+ G+DKL+ AI+ VFLG Sbjct: 667 VSPRVFGCVCFVHDLSPGLDKLSARAIKCVFLG 699 Score = 37.0 bits (84), Expect(2) = 5e-07 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRS 262 SR KGY C+ RR+Y+S DVTF+E +F S Sbjct: 701 SRLQKGYRCYSPDTRRYYMSADVTFFEDTSFFSSS 735 >ref|XP_020218720.1| uncharacterized protein LOC109801952 isoform X2 [Cajanus cajan] Length = 839 Score = 44.3 bits (103), Expect(2) = 5e-07 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 ++PR+FGC+C+V+ G+DKL+ AI+ VFLG Sbjct: 661 VSPRVFGCVCFVHDLSPGLDKLSARAIKCVFLG 693 Score = 37.0 bits (84), Expect(2) = 5e-07 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRS 262 SR KGY C+ RR+Y+S DVTF+E +F S Sbjct: 695 SRLQKGYRCYSPDTRRYYMSADVTFFEDTSFFSSS 729 >ref|XP_014518773.2| uncharacterized protein LOC106776001 isoform X1 [Vigna radiata var. radiata] Length = 479 Score = 43.1 bits (100), Expect(2) = 5e-07 Identities = 18/33 (54%), Positives = 26/33 (78%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 ++PRIFGC C+V++ G+DKL+ AI+ VFLG Sbjct: 204 VSPRIFGCTCFVHNVSPGLDKLSAKAIKCVFLG 236 Score = 38.1 bits (87), Expect(2) = 5e-07 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LSKVLQLFYLLRC 211 SR KGY C+ +R+Y+S DVTF+E +F S S V Q+F L C Sbjct: 238 SRLQKGYKCYCPSTKRYYMSADVTFFECTSFFL-SFMEDRSSVQQMFPLPSC 288 >gb|ABI34342.1| Polyprotein, putative [Solanum demissum] Length = 1054 Score = 42.0 bits (97), Expect(2) = 6e-07 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = -2 Query: 470 PLTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLGSHEPKK 351 P+ PR+FG C+V++ G DKL P A++ VFLG +K Sbjct: 466 PIPPRVFGSTCFVHNLAPGKDKLAPRALKCVFLGYSRVQK 505 Score = 38.9 bits (89), Expect(2) = 6e-07 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LSKVLQL 229 SR KGY C+ R+ +S DVTF+E PY+ S + +S VL + Sbjct: 501 SRVQKGYRCYSHDLHRYLMSADVTFFESQPYYTSSDHPDVSMVLPI 546 >emb|CAN79305.1| hypothetical protein VITISV_036286 [Vitis vinifera] Length = 546 Score = 42.7 bits (99), Expect(2) = 7e-07 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 3/57 (5%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRSTYT*LSKVLQL---FYLLRCHL 205 SR KGY C+ S R+++S DVTF+E P+F S +S+VL L +L++C L Sbjct: 117 SRLQKGYRCYSSETHRYFLSADVTFFEDSPFFSTSESLPISEVLLLPIISHLMQCLL 173 Score = 38.1 bits (87), Expect(2) = 7e-07 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -2 Query: 461 PRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 PR+FGC C+VY G DKL+ A + +FLG Sbjct: 85 PRVFGCTCFVYILTPGQDKLSARATKCIFLG 115 >dbj|BAT82265.1| hypothetical protein VIGAN_03224900 [Vigna angularis var. angularis] Length = 184 Score = 40.8 bits (94), Expect(2) = 7e-07 Identities = 16/33 (48%), Positives = 26/33 (78%) Frame = -2 Query: 467 LTPRIFGCICYVYSFGRGIDKLTPCAIR*VFLG 369 ++PR+FG C+V++ G+DKL+P +I+ VFLG Sbjct: 24 VSPRVFGSTCFVHNVSPGLDKLSPKSIKCVFLG 56 Score = 40.0 bits (92), Expect(2) = 7e-07 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -1 Query: 366 SRT*KGYWCFDSIQRRHYISVDVTFYELVPYFYRS 262 SR KGY C+ RR+Y+S DVTF+E P+F S Sbjct: 58 SRIQKGYRCYSPSTRRYYMSSDVTFFEDTPFFLSS 92