BLASTX nr result
ID: Cheilocostus21_contig00065235
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00065235 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP51543.1| Retrovirus-related Pol polyprotein from transposo... 58 9e-07 gb|KYP31378.1| Retrovirus-related Pol polyprotein from transposo... 55 8e-06 >gb|KYP51543.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 439 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +2 Query: 287 SCDVCQLGLYYRVSFLPS*HSKGSSPFDKVHFDIWSPSFDPLKI-VLIMCYFFDDYPR 457 SC+ CQLG + R SF PS H++ SPF VH+DIW PS P + L F DDY R Sbjct: 358 SCESCQLGKHSRSSFSPSVHNRALSPFALVHYDIWGPSRVPSTLGFLYFVTFIDDYSR 415 >gb|KYP31378.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 585 Score = 55.1 bits (131), Expect = 8e-06 Identities = 29/58 (50%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +2 Query: 287 SCDVCQLGLYYRVSFLPS*HSKGSSPFDKVHFDIWSPSFDPLKI-VLIMCYFFDDYPR 457 SC+ CQLG + R SF PS H + SSPF VH DIW PS P + F DDY R Sbjct: 491 SCESCQLGKHSRSSFSPSVHKQASSPFALVHSDIWGPSRVPSTLGFQYFVTFIDDYSR 548