BLASTX nr result
ID: Cheilocostus21_contig00064555
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00064555 (479 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AMN88380.1| polyprotein [Grapevine roditis leaf discoloration... 58 1e-06 ref|YP_009140788.1| polyprotein [Grapevine roditis leaf discolor... 57 2e-06 >gb|AMN88380.1| polyprotein [Grapevine roditis leaf discoloration-associated virus] Length = 1789 Score = 57.8 bits (138), Expect = 1e-06 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 16/90 (17%) Frame = -3 Query: 477 RYDSTAVEGRHWIVRPTQEIRLRLPTEVQSRNLINGSINISFDNYLATPA-------QAT 319 RY+S + GR+WI+R Q +P VQ+ NL++GSI+ F NY P + Sbjct: 270 RYNSDILRGRNWIIRQPQLQVTMMPRSVQTTNLLDGSISARFANYTQAPEPQQPCYNEHD 329 Query: 318 EEE---------MQHHIIAYFREEGITDLE 256 EEE QHH++A FR G T++E Sbjct: 330 EEEASDEAELAATQHHVVAMFRLSGYTEVE 359 >ref|YP_009140788.1| polyprotein [Grapevine roditis leaf discoloration-associated virus] emb|CDN68224.1| polyprotein [Grapevine roditis leaf discoloration-associated virus] Length = 1830 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/90 (35%), Positives = 48/90 (53%), Gaps = 16/90 (17%) Frame = -3 Query: 477 RYDSTAVEGRHWIVRPTQEIRLRLPTEVQSRNLINGSINISFDNYLATP----------- 331 RY+S + GR+WI+R Q +P VQ+ NL++GSI+ F NY P Sbjct: 272 RYNSDMLRGRNWIIRQPQLQVTMMPRSVQTTNLLDGSISARFANYTQAPEPQQPRYNGHD 331 Query: 330 -AQATEE----EMQHHIIAYFREEGITDLE 256 +A++E QHH++A FR G T++E Sbjct: 332 EEEASDEAELAATQHHVVAMFRLSGYTEVE 361