BLASTX nr result
ID: Cheilocostus21_contig00064207
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00064207 (623 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAT79052.1| hypothetical protein VIGAN_02185400, partial [Vi... 78 5e-15 dbj|BAT76296.1| hypothetical protein VIGAN_01427700, partial [Vi... 77 1e-14 dbj|BAU03608.1| hypothetical protein VIGAN_UM141900, partial [Vi... 77 2e-14 gb|OWM65682.1| hypothetical protein CDL15_Pgr017179 [Punica gran... 76 2e-14 gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposo... 75 6e-14 dbj|BAT73483.1| hypothetical protein VIGAN_01097100, partial [Vi... 77 1e-13 ref|XP_018716005.1| PREDICTED: uncharacterized protein LOC108954... 64 1e-13 gb|KOM25357.1| hypothetical protein LR48_Vigan102s001500 [Vigna ... 77 2e-13 gb|KYP63600.1| Retrovirus-related Pol polyprotein from transposo... 74 2e-13 gb|KOM48353.1| hypothetical protein LR48_Vigan07g205700 [Vigna a... 77 2e-13 ref|XP_014632964.1| PREDICTED: uncharacterized protein LOC106799... 72 7e-13 gb|KYP63559.1| Retrovirus-related Pol polyprotein from transposo... 73 9e-13 ref|XP_020218720.1| uncharacterized protein LOC109801952 isoform... 73 9e-13 gb|KYP44825.1| Retrovirus-related Pol polyprotein from transposo... 70 1e-12 gb|KOM56592.1| hypothetical protein LR48_Vigan10g248400 [Vigna a... 72 1e-12 gb|OWM72270.1| hypothetical protein CDL15_Pgr018155 [Punica gran... 71 2e-12 gb|KOM54435.1| hypothetical protein LR48_Vigan10g032700 [Vigna a... 71 5e-12 gb|KOM38790.1| hypothetical protein LR48_Vigan03g217200 [Vigna a... 71 1e-11 gb|KOM46148.1| hypothetical protein LR48_Vigan06g145400 [Vigna a... 70 2e-11 gb|KYP34536.1| Retrovirus-related Pol polyprotein from transposo... 71 3e-11 >dbj|BAT79052.1| hypothetical protein VIGAN_02185400, partial [Vigna angularis var. angularis] Length = 111 Score = 77.8 bits (190), Expect = 5e-15 Identities = 32/65 (49%), Positives = 44/65 (67%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 CVC+VH + P L KL R + CVF GY + QK Y C+ PE +++Y+SANV F+E PYF Sbjct: 31 CVCFVHDMSPGLDKLSARALKCVFLGYSRLQKGYRCYSPETKKYYMSANVTFFEQTPYFS 90 Query: 400 KSIHN 414 S+ + Sbjct: 91 PSVQD 95 >dbj|BAT76296.1| hypothetical protein VIGAN_01427700, partial [Vigna angularis var. angularis] Length = 125 Score = 77.0 bits (188), Expect = 1e-14 Identities = 31/65 (47%), Positives = 44/65 (67%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 CVC+VH + P L KL R + CVF GY + QK Y C+ PE +++Y+SANV F+E P+F Sbjct: 31 CVCFVHDMSPGLDKLSARAIKCVFLGYSRLQKGYRCYSPETKKYYMSANVTFFEQTPFFS 90 Query: 400 KSIHN 414 S+ + Sbjct: 91 PSVQD 95 >dbj|BAU03608.1| hypothetical protein VIGAN_UM141900, partial [Vigna angularis var. angularis] Length = 133 Score = 77.0 bits (188), Expect = 2e-14 Identities = 31/65 (47%), Positives = 44/65 (67%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 CVC+VH + P L KL R + CVF GY + QK Y C+ PE +++Y+SANV F+E P+F Sbjct: 31 CVCFVHDMSPGLDKLSARAIKCVFLGYSRLQKGYRCYSPETKKYYMSANVTFFEQTPFFS 90 Query: 400 KSIHN 414 S+ + Sbjct: 91 PSVQD 95 >gb|OWM65682.1| hypothetical protein CDL15_Pgr017179 [Punica granatum] Length = 742 Score = 75.9 bits (185), Expect(2) = 2e-14 Identities = 32/62 (51%), Positives = 44/62 (70%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C+C++H L P KL PR + CVF GYL+ QK Y C+ PE+RR++V A+V F+ES P+F Sbjct: 211 CLCFIHQLLPGSSKLSPRSLKCVFLGYLRGQKGYRCYSPEQRRYFVVADVTFFESTPFFS 270 Query: 400 KS 405 S Sbjct: 271 AS 272 Score = 31.2 bits (69), Expect(2) = 2e-14 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +3 Query: 54 IMFHIHILRSF*TNVILTAIFLINHI*LSGLQGLSPFSMFF 176 ++ H+++ F + +LTA +LIN + S L G PFS+ F Sbjct: 156 LLIHMNVPVKFWGDALLTACYLINRMPSSVLHGQIPFSVLF 196 >gb|KHN06274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 1353 Score = 75.1 bits (183), Expect(2) = 6e-14 Identities = 32/67 (47%), Positives = 43/67 (64%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C C+VH L P L KL R + CVF GY + QK Y CF P RR+Y+SA+V F+E P++ Sbjct: 655 CTCFVHNLSPGLDKLSARAIKCVFLGYSRLQKGYKCFSPSTRRYYMSADVTFFEDTPFYP 714 Query: 400 KSIHNST 420 S +S+ Sbjct: 715 SSTDHSS 721 Score = 30.0 bits (66), Expect(2) = 6e-14 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +3 Query: 54 IMFHIHILRSF*TNVILTAIFLINHI*LSGLQGLSPFSMFFYLKFSFH*HHKYLNVCMLC 233 +M H+ + +LTA FLIN + S L+ P S+ F FH K C Sbjct: 600 LMLASHVPTHHWGDAVLTACFLINRMPSSSLENQIPHSIIFPHDHLFHVPPKVFG----C 655 Query: 234 SCF 242 +CF Sbjct: 656 TCF 658 >dbj|BAT73483.1| hypothetical protein VIGAN_01097100, partial [Vigna angularis var. angularis] Length = 198 Score = 76.6 bits (187), Expect = 1e-13 Identities = 31/65 (47%), Positives = 43/65 (66%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 CVC+VH + P L KL R + CVF GY + QK Y C+ PE +++Y+S NV F+E PYF Sbjct: 31 CVCFVHNMSPGLDKLSARALKCVFLGYSRLQKGYQCYSPETKKYYMSVNVTFFEQTPYFF 90 Query: 400 KSIHN 414 S+ + Sbjct: 91 PSVQD 95 >ref|XP_018716005.1| PREDICTED: uncharacterized protein LOC108954459 [Eucalyptus grandis] Length = 878 Score = 63.5 bits (153), Expect(2) = 1e-13 Identities = 29/54 (53%), Positives = 35/54 (64%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYE 381 CVC+VH L P L L PR CVF GY +TQK Y C+ P RR +VS +V F+E Sbjct: 822 CVCFVHNLTPGLDILDPRAEKCVFVGYSRTQKGYKCYCPSRRHMFVSTDVTFFE 875 Score = 40.4 bits (93), Expect(2) = 1e-13 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 15 KESHMTYF*YCSHIMFHIHILRSF*TNVILTAIFLINHI*LSGLQGLSPFSM 170 K H+ +C +MFH+H+ + F + +LT +LIN + S LQG +PFS+ Sbjct: 756 KNCHLLDVAHC--LMFHMHLPKHFWGHAVLTVCYLINRLPTSVLQGKTPFSL 805 >gb|KOM25357.1| hypothetical protein LR48_Vigan102s001500 [Vigna angularis] Length = 250 Score = 77.0 bits (188), Expect = 2e-13 Identities = 31/65 (47%), Positives = 44/65 (67%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 CVC+VH + P L KL R + CVF GY + QK Y C+ PE +++Y+SANV F+E P+F Sbjct: 31 CVCFVHDMSPGLDKLSARAIKCVFLGYSRLQKGYRCYSPETKKYYMSANVTFFEQTPFFS 90 Query: 400 KSIHN 414 S+ + Sbjct: 91 PSVQD 95 >gb|KYP63600.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 334 Score = 74.3 bits (181), Expect(2) = 2e-13 Identities = 30/66 (45%), Positives = 44/66 (66%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C C+VH + P L KL R + CVF GY + QK Y C+ P+ R+ Y+SA+V F+E P+F+ Sbjct: 252 CTCFVHNVSPGLDKLSARAIKCVFLGYSRLQKGYKCYSPKTRKFYMSADVTFFEQTPFFY 311 Query: 400 KSIHNS 417 + H+S Sbjct: 312 CTTHDS 317 Score = 29.3 bits (64), Expect(2) = 2e-13 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +3 Query: 93 NVILTAIFLINHI*LSGLQGLSPFSMFFYLKFSFH*HHKYLNVCMLCSCF 242 + ILT+ FLIN + S L+ +P+S+ + + FH + C+CF Sbjct: 210 DAILTSCFLINRMPSSSLENKTPYSIIYPKEPLFHVSPRVFG----CTCF 255 >gb|KOM48353.1| hypothetical protein LR48_Vigan07g205700 [Vigna angularis] Length = 287 Score = 77.0 bits (188), Expect(2) = 2e-13 Identities = 31/65 (47%), Positives = 44/65 (67%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 CVC+VH + P L KL R + CVF GY + QK Y C+ PE +++Y+SANV F+E P+F Sbjct: 210 CVCFVHDMSPGLDKLSARAIKCVFLGYSRLQKGYRCYSPETKKYYMSANVTFFEQTPFFS 269 Query: 400 KSIHN 414 S+ + Sbjct: 270 PSVQD 274 Score = 26.6 bits (57), Expect(2) = 2e-13 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = +3 Query: 93 NVILTAIFLINHI*LSGLQGLSPFSMFFYLKFSFH*HHKYLNVCMLCSCF 242 + ILTA FLIN + S L PF + F FH + C CF Sbjct: 168 DAILTACFLINRMLSSSLNNKVPFFVLFPNNPLFHTSPRVFG----CVCF 213 >ref|XP_014632964.1| PREDICTED: uncharacterized protein LOC106799283 [Glycine max] Length = 706 Score = 71.6 bits (174), Expect(2) = 7e-13 Identities = 30/67 (44%), Positives = 41/67 (61%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C C+VH L P L KL R + CVF Y + QK Y CF P RR+Y+S +V F+E P++ Sbjct: 503 CTCFVHDLSPGLDKLSARAIKCVFLAYCRLQKGYKCFSPSTRRYYMSTDVTFFEDTPFYP 562 Query: 400 KSIHNST 420 S +S+ Sbjct: 563 SSTDHSS 569 Score = 30.0 bits (66), Expect(2) = 7e-13 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +3 Query: 54 IMFHIHILRSF*TNVILTAIFLINHI*LSGLQGLSPFSMFFYLKFSFH*HHKYLNVCMLC 233 +M H+ + +LTA FLIN + S L+ P S+ F FH K C Sbjct: 448 LMLASHVPTHHWGDAVLTACFLINRMPSSSLENQIPHSIIFPHDHLFHVPPKVFG----C 503 Query: 234 SCF 242 +CF Sbjct: 504 TCF 506 >gb|KYP63559.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1378 Score = 73.2 bits (178), Expect(2) = 9e-13 Identities = 31/63 (49%), Positives = 42/63 (66%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 CVC+VH L P L KL R + CVF GY + QK Y C+ P+ RR+Y+SA+V F+E +F Sbjct: 674 CVCFVHDLSPGLDKLSARAIKCVFLGYSRLQKGYRCYSPDTRRYYMSADVTFFEDTSFFS 733 Query: 400 KSI 408 S+ Sbjct: 734 SSM 736 Score = 28.1 bits (61), Expect(2) = 9e-13 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +3 Query: 93 NVILTAIFLINHI*LSGLQGLSPFSMFFYLKFSFH*HHKYLNVCMLCSCF 242 + ILTA FLIN + S L P+S+ F + FH + C CF Sbjct: 632 DAILTACFLINRMPSSSLDNKIPYSILFPNEPLFHVSPRVFG----CVCF 677 >ref|XP_020218720.1| uncharacterized protein LOC109801952 isoform X2 [Cajanus cajan] Length = 839 Score = 73.2 bits (178), Expect(2) = 9e-13 Identities = 31/63 (49%), Positives = 42/63 (66%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 CVC+VH L P L KL R + CVF GY + QK Y C+ P+ RR+Y+SA+V F+E +F Sbjct: 668 CVCFVHDLSPGLDKLSARAIKCVFLGYSRLQKGYRCYSPDTRRYYMSADVTFFEDTSFFS 727 Query: 400 KSI 408 S+ Sbjct: 728 SSM 730 Score = 28.1 bits (61), Expect(2) = 9e-13 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +3 Query: 93 NVILTAIFLINHI*LSGLQGLSPFSMFFYLKFSFH*HHKYLNVCMLCSCF 242 + ILTA FLIN + S L P+S+ F + FH + C CF Sbjct: 626 DAILTACFLINRMPSSSLDNKIPYSILFPNEPLFHVSPRVFG----CVCF 671 >gb|KYP44825.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1371 Score = 70.5 bits (171), Expect(2) = 1e-12 Identities = 29/66 (43%), Positives = 43/66 (65%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C C+VH + P L KL R + CVF GY + QK Y C+ P+ ++ Y+SA+V F+E P+F Sbjct: 668 CTCFVHDVSPGLDKLSARAIKCVFLGYSRLQKGYKCYSPKTKKFYMSADVTFFEHTPFFL 727 Query: 400 KSIHNS 417 S ++S Sbjct: 728 SSTNDS 733 Score = 30.4 bits (67), Expect(2) = 1e-12 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = +3 Query: 93 NVILTAIFLINHI*LSGLQGLSPFSMFFYLKFSFH*HHKYLNVCMLCSCF 242 + ILTA FLIN + S L+ P+S+ F + FH + C+CF Sbjct: 626 DAILTACFLINRMPSSSLENKIPYSIIFPKEPLFHVSPRVFG----CTCF 671 >gb|KOM56592.1| hypothetical protein LR48_Vigan10g248400 [Vigna angularis] Length = 120 Score = 71.6 bits (174), Expect = 1e-12 Identities = 29/62 (46%), Positives = 41/62 (66%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C C+VH + P L KL P+ + CVF GY + QK Y C+ P RR+Y+S++V F+E P+F Sbjct: 31 CTCFVHNVSPGLDKLSPKSIKCVFLGYSRIQKGYRCYSPSTRRYYMSSDVTFFEDTPFFL 90 Query: 400 KS 405 S Sbjct: 91 SS 92 >gb|OWM72270.1| hypothetical protein CDL15_Pgr018155 [Punica granatum] Length = 1054 Score = 71.2 bits (173), Expect(2) = 2e-12 Identities = 32/66 (48%), Positives = 45/66 (68%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C+C+VH L P KL PR + CVF GY + QK Y C+ E+RR++V A+V F+ES P+F Sbjct: 347 CLCFVHQLLPGSSKLSPRSLKCVFLGYPRGQKGYRCYSLEQRRYFVIADVTFFESTPFFS 406 Query: 400 KSIHNS 417 +S + S Sbjct: 407 ESPNQS 412 Score = 28.9 bits (63), Expect(2) = 2e-12 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 54 IMFHIHILRSF*TNVILTAIFLINHI*LSGLQGLSPFSMFF 176 ++ H+++ F + +LTA +LIN + S L G PF + F Sbjct: 292 LLIHMNVPVKFWGDALLTACYLINRMPSSVLHGQIPFLVLF 332 >gb|KOM54435.1| hypothetical protein LR48_Vigan10g032700 [Vigna angularis] Length = 160 Score = 71.2 bits (173), Expect = 5e-12 Identities = 28/65 (43%), Positives = 43/65 (66%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C+C+VH + P L KL + + CVF GY + QK Y C+ P +R+Y+SA+V F+E P+F Sbjct: 55 CMCFVHNVSPGLDKLSAKAIKCVFLGYSRLQKGYKCYSPSTKRYYMSADVTFFEDTPFFP 114 Query: 400 KSIHN 414 S+ + Sbjct: 115 SSMED 119 >gb|KOM38790.1| hypothetical protein LR48_Vigan03g217200 [Vigna angularis] Length = 1119 Score = 71.2 bits (173), Expect(2) = 1e-11 Identities = 29/62 (46%), Positives = 41/62 (66%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C C+VH + P L KL P+ + CVF GY + QK Y C+ P RR+Y+S++V F+E P+F Sbjct: 427 CTCFVHNVSPGLDKLSPKSIKCVFLGYSRIQKGYRCYSPSTRRNYMSSDVTFFEDTPFFL 486 Query: 400 KS 405 S Sbjct: 487 SS 488 Score = 26.2 bits (56), Expect(2) = 1e-11 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +3 Query: 93 NVILTAIFLINHI*LSGLQGLSPFSMFFYLKFSFH*HHKYLNVCMLCSCF 242 + ILTA F IN + S L+ P+S+ F +H + C+CF Sbjct: 385 DAILTACFQINRMPSSSLENKVPYSVIFPNDALYHIPPRVFG----CTCF 430 >gb|KOM46148.1| hypothetical protein LR48_Vigan06g145400 [Vigna angularis] Length = 194 Score = 70.5 bits (171), Expect = 2e-11 Identities = 29/65 (44%), Positives = 43/65 (66%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C+C+VH + P L KL + + CVFFGY QK Y C+ P +R+Y+SA+V F+E P+F Sbjct: 55 CMCFVHNVSPGLDKLSLKAIKCVFFGYSCLQKCYKCYSPSTKRYYMSADVTFFEHTPFFL 114 Query: 400 KSIHN 414 S+ + Sbjct: 115 SSMED 119 >gb|KYP34536.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 372 Score = 70.9 bits (172), Expect(2) = 3e-11 Identities = 30/66 (45%), Positives = 42/66 (63%) Frame = +1 Query: 220 CVCYVHALRPELHKLRPRVVCCVFFGYLQTQK*YSCFDPERRRHYVSANVIFYESVPYFH 399 C C+VH + P L KL R + CVF GY + QK Y C+ PE R+ Y+SA+V F+E +F Sbjct: 258 CTCFVHNVSPGLDKLSARAIKCVFLGYSRLQKGYKCYSPETRKLYMSADVTFFEQTSFFS 317 Query: 400 KSIHNS 417 + H+S Sbjct: 318 CTTHDS 323 Score = 25.4 bits (54), Expect(2) = 3e-11 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +3 Query: 93 NVILTAIFLINHI*LSGLQGLSPFSMFFYLKFSFH*HHKYLNVCMLCSCF 242 + ILT+ FLIN + S L+ P+S+ + + F+ + C+CF Sbjct: 216 DAILTSCFLINMMPSSSLENKIPYSIIYTKEPLFYVSPRVFG----CTCF 261