BLASTX nr result
ID: Cheilocostus21_contig00063749
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00063749 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU61118.1| hypothetical protein MA16_Dca028353 [Dendrobium c... 58 2e-07 ref|XP_020685009.1| uncharacterized protein LOC110101440 [Dendro... 59 3e-07 ref|XP_020576144.1| uncharacterized protein LOC110021822 [Phalae... 57 2e-06 ref|XP_020592712.1| uncharacterized protein LOC110033161 [Phalae... 55 6e-06 gb|PKU61724.1| hypothetical protein MA16_Dca023190 [Dendrobium c... 55 9e-06 >gb|PKU61118.1| hypothetical protein MA16_Dca028353 [Dendrobium catenatum] Length = 193 Score = 58.2 bits (139), Expect = 2e-07 Identities = 24/52 (46%), Positives = 37/52 (71%) Frame = -1 Query: 157 KATLYKK*GKPYPPEFNDVPYPRGYIVPNFKMFDGVGSLD*NITHFVAKCRN 2 +++ Y G+PYP EF+ VPYP+G++ P+FK+FDG G+ +I +F A C N Sbjct: 80 QSSSYTPKGRPYPEEFDAVPYPKGFVPPSFKIFDGTGNPRQHIAYFRASCCN 131 >ref|XP_020685009.1| uncharacterized protein LOC110101440 [Dendrobium catenatum] Length = 732 Score = 58.9 bits (141), Expect = 3e-07 Identities = 23/44 (52%), Positives = 32/44 (72%) Frame = -1 Query: 133 GKPYPPEFNDVPYPRGYIVPNFKMFDGVGSLD*NITHFVAKCRN 2 G+PYP EF+ VPYP+G++ P+FK FDG G+ ++ HF A C N Sbjct: 22 GRPYPEEFDSVPYPKGFVPPSFKNFDGTGNPKQHLAHFRASCCN 65 >ref|XP_020576144.1| uncharacterized protein LOC110021822 [Phalaenopsis equestris] Length = 483 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/44 (50%), Positives = 32/44 (72%) Frame = -1 Query: 133 GKPYPPEFNDVPYPRGYIVPNFKMFDGVGSLD*NITHFVAKCRN 2 G+PYP EF+ V YP+G+++P+FK FDG G+ ++ HF A C N Sbjct: 270 GRPYPEEFDAVQYPKGFVLPSFKTFDGTGNPRQHVAHFRASCCN 313 >ref|XP_020592712.1| uncharacterized protein LOC110033161 [Phalaenopsis equestris] Length = 300 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/62 (40%), Positives = 40/62 (64%) Frame = -1 Query: 187 WDQLKHIKIDKATLYKK*GKPYPPEFNDVPYPRGYIVPNFKMFDGVGSLD*NITHFVAKC 8 W + +H+ + + ++K G+PYP EF+DV Y +G++ P FK FDG G+ ++ HF A C Sbjct: 2 WWKPEHLHLYER--HQKRGRPYPEEFDDVQYLKGFVPPLFKNFDGTGNPRQHVAHFRASC 59 Query: 7 RN 2 N Sbjct: 60 YN 61 >gb|PKU61724.1| hypothetical protein MA16_Dca023190 [Dendrobium catenatum] Length = 502 Score = 54.7 bits (130), Expect = 9e-06 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = -1 Query: 145 YKK*GKPYPPEFNDVPYPRGYIVPNFKMFDGVGSLD*NITHFVAKCRN 2 Y G+PY EF+ VPYP+G++ P+FK+FDG G+ +I++F A C N Sbjct: 368 YTPKGRPYLEEFDAVPYPKGFVPPSFKIFDGTGNSRQHISYFRASCCN 415