BLASTX nr result
ID: Cheilocostus21_contig00063556
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00063556 (757 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009414055.1| PREDICTED: transmembrane protein 50A [Musa a... 66 7e-10 gb|ONK61396.1| uncharacterized protein A4U43_C08F29470 [Asparagu... 60 1e-07 ref|XP_020244137.1| transmembrane protein 50A [Asparagus officin... 60 1e-07 gb|ONM22273.1| Transmembrane protein 50A [Zea mays] >gi|11426629... 59 1e-07 ref|XP_010908152.1| PREDICTED: transmembrane protein 50A [Elaeis... 57 1e-06 ref|XP_010943101.1| PREDICTED: transmembrane protein 50A [Elaeis... 57 1e-06 gb|ONM22272.1| Transmembrane protein 50A [Zea mays] 55 2e-06 ref|XP_008775814.1| PREDICTED: transmembrane protein 50A [Phoeni... 55 4e-06 ref|XP_020704164.1| transmembrane protein 50 homolog [Dendrobium... 55 5e-06 gb|OAY85282.1| hypothetical protein ACMD2_04133 [Ananas comosus] 54 6e-06 emb|CDP20983.1| unnamed protein product [Coffea canephora] 42 8e-06 ref|XP_008777670.1| PREDICTED: transmembrane protein 50A-like [P... 55 8e-06 gb|PAN12724.1| hypothetical protein PAHAL_B03043 [Panicum hallii] 55 9e-06 gb|OEL30435.1| hypothetical protein BAE44_0008546 [Dichanthelium... 55 9e-06 gb|ACG40145.1| transmembrane protein 50A [Zea mays] 55 9e-06 ref|NP_001335968.1| uncharacterized LOC100281814 [Zea mays] >gi|... 55 9e-06 ref|XP_004956989.1| transmembrane protein 50 homolog [Setaria it... 55 9e-06 >ref|XP_009414055.1| PREDICTED: transmembrane protein 50A [Musa acuminata subsp. malaccensis] Length = 140 Score = 65.9 bits (159), Expect = 7e-10 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYGETEWR 377 IFAS+AAL+FNCVDKN++GY+YY+PYGETEWR Sbjct: 47 IFASLAALMFNCVDKNEIGYDYYSPYGETEWR 78 >gb|ONK61396.1| uncharacterized protein A4U43_C08F29470 [Asparagus officinalis] Length = 135 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYGETEWR 377 IFAS+AAL+FNCV K D+GY+YY+PYG++EWR Sbjct: 37 IFASLAALMFNCVKKEDIGYDYYSPYGDSEWR 68 >ref|XP_020244137.1| transmembrane protein 50A [Asparagus officinalis] Length = 141 Score = 59.7 bits (143), Expect = 1e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYGETEWR 377 IFAS+AAL+FNCV K D+GY+YY+PYG++EWR Sbjct: 48 IFASLAALMFNCVKKEDIGYDYYSPYGDSEWR 79 >gb|ONM22273.1| Transmembrane protein 50A [Zea mays] gb|ONM22275.1| Transmembrane protein 50A [Zea mays] Length = 99 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/46 (56%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYG-ETEWRYGFCDLSKCVFLV 338 IFAS+AAL+FNCV+K+++GY+YY+PYG ++EWR F ++ FLV Sbjct: 47 IFASLAALMFNCVNKDEIGYDYYSPYGDDSEWRVRFYRVTCTCFLV 92 >ref|XP_010908152.1| PREDICTED: transmembrane protein 50A [Elaeis guineensis] Length = 140 Score = 57.0 bits (136), Expect = 1e-06 Identities = 21/32 (65%), Positives = 31/32 (96%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYGETEWR 377 IFAS+AAL+FNCV+++D+ Y+YY+PYG++EWR Sbjct: 47 IFASLAALMFNCVNRDDVSYDYYSPYGDSEWR 78 >ref|XP_010943101.1| PREDICTED: transmembrane protein 50A [Elaeis guineensis] Length = 140 Score = 57.0 bits (136), Expect = 1e-06 Identities = 21/32 (65%), Positives = 31/32 (96%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYGETEWR 377 IFAS+AAL+FNCV+++D+ Y+YY+PYG++EWR Sbjct: 47 IFASLAALMFNCVNRDDVSYDYYSPYGDSEWR 78 >gb|ONM22272.1| Transmembrane protein 50A [Zea mays] Length = 79 Score = 54.7 bits (130), Expect = 2e-06 Identities = 22/33 (66%), Positives = 32/33 (96%), Gaps = 1/33 (3%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYG-ETEWR 377 IFAS+AAL+FNCV+K+++GY+YY+PYG ++EWR Sbjct: 47 IFASLAALMFNCVNKDEIGYDYYSPYGDDSEWR 79 >ref|XP_008775814.1| PREDICTED: transmembrane protein 50A [Phoenix dactylifera] Length = 140 Score = 55.5 bits (132), Expect = 4e-06 Identities = 20/32 (62%), Positives = 30/32 (93%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYGETEWR 377 IFAS+AA +FNCV+++D+ Y+YY+PYG++EWR Sbjct: 47 IFASLAAFMFNCVNRDDVSYDYYSPYGDSEWR 78 >ref|XP_020704164.1| transmembrane protein 50 homolog [Dendrobium catenatum] gb|PKU79898.1| hypothetical protein MA16_Dca012086 [Dendrobium catenatum] Length = 141 Score = 55.5 bits (132), Expect = 5e-06 Identities = 21/32 (65%), Positives = 29/32 (90%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYGETEWR 377 IFAS+AAL+FNCV K ++ Y+YY+PYGE++WR Sbjct: 48 IFASLAALMFNCVRKEEIAYDYYSPYGESDWR 79 >gb|OAY85282.1| hypothetical protein ACMD2_04133 [Ananas comosus] Length = 93 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYGETEWRY-GFCDLSKCVFLV 338 IFAS+AAL+FNCV ++D+ Y Y+PY +TEWR+ F +S+ L+ Sbjct: 48 IFASLAALMFNCVSRDDVSYGSYSPYDDTEWRFDSFDSISEFALLI 93 >emb|CDP20983.1| unnamed protein product [Coffea canephora] Length = 124 Score = 42.4 bits (98), Expect(2) = 8e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYGETEWR 377 IFAS+AAL+FNCV K D+ Y+PY E EWR Sbjct: 45 IFASLAALMFNCVRKEDID---YSPYEEGEWR 73 Score = 36.2 bits (82), Expect(2) = 8e-06 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -3 Query: 656 AIFVAKWWF*IDAIVCCTVKVS 591 A+F A WWF +DA+VC +VKVS Sbjct: 17 AVFGAGWWFWVDAVVCSSVKVS 38 >ref|XP_008777670.1| PREDICTED: transmembrane protein 50A-like [Phoenix dactylifera] Length = 140 Score = 54.7 bits (130), Expect = 8e-06 Identities = 20/32 (62%), Positives = 30/32 (93%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYGETEWR 377 I AS+AAL+FNCV+++D+ Y+YY+PYG++EWR Sbjct: 47 ILASLAALMFNCVNRDDVSYDYYSPYGDSEWR 78 >gb|PAN12724.1| hypothetical protein PAHAL_B03043 [Panicum hallii] Length = 141 Score = 54.7 bits (130), Expect = 9e-06 Identities = 22/33 (66%), Positives = 32/33 (96%), Gaps = 1/33 (3%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYG-ETEWR 377 IFAS+AAL+FNCV+K+++GY+YY+PYG ++EWR Sbjct: 47 IFASLAALMFNCVNKDEIGYDYYSPYGDDSEWR 79 >gb|OEL30435.1| hypothetical protein BAE44_0008546 [Dichanthelium oligosanthes] Length = 141 Score = 54.7 bits (130), Expect = 9e-06 Identities = 22/33 (66%), Positives = 32/33 (96%), Gaps = 1/33 (3%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYG-ETEWR 377 IFAS+AAL+FNCV+K+++GY+YY+PYG ++EWR Sbjct: 47 IFASLAALMFNCVNKDEIGYDYYSPYGDDSEWR 79 >gb|ACG40145.1| transmembrane protein 50A [Zea mays] Length = 141 Score = 54.7 bits (130), Expect = 9e-06 Identities = 22/33 (66%), Positives = 32/33 (96%), Gaps = 1/33 (3%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYG-ETEWR 377 IFAS+AAL+FNCV+K+++GY+YY+PYG ++EWR Sbjct: 47 IFASLAALMFNCVNKDEIGYDYYSPYGDDSEWR 79 >ref|NP_001335968.1| uncharacterized LOC100281814 [Zea mays] ref|XP_002462478.1| transmembrane protein 50 homolog [Sorghum bicolor] gb|ACG30175.1| transmembrane protein 50A [Zea mays] gb|ACG39153.1| transmembrane protein 50A [Zea mays] gb|EER98999.1| hypothetical protein SORBI_3002G222900 [Sorghum bicolor] gb|ONM22274.1| Transmembrane protein 50A [Zea mays] Length = 141 Score = 54.7 bits (130), Expect = 9e-06 Identities = 22/33 (66%), Positives = 32/33 (96%), Gaps = 1/33 (3%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYG-ETEWR 377 IFAS+AAL+FNCV+K+++GY+YY+PYG ++EWR Sbjct: 47 IFASLAALMFNCVNKDEIGYDYYSPYGDDSEWR 79 >ref|XP_004956989.1| transmembrane protein 50 homolog [Setaria italica] gb|KQL24755.1| hypothetical protein SETIT_031452mg [Setaria italica] Length = 141 Score = 54.7 bits (130), Expect = 9e-06 Identities = 22/33 (66%), Positives = 32/33 (96%), Gaps = 1/33 (3%) Frame = -1 Query: 472 IFASIAALVFNCVDKNDLGYNYYTPYG-ETEWR 377 IFAS+AAL+FNCV+K+++GY+YY+PYG ++EWR Sbjct: 47 IFASLAALMFNCVNKDEIGYDYYSPYGDDSEWR 79