BLASTX nr result
ID: Cheilocostus21_contig00063198
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00063198 (620 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN20004.1| hypothetical protein AMTR_s00071p00160110 [Ambore... 58 2e-06 gb|ERN20008.1| hypothetical protein AMTR_s00071p00160560 [Ambore... 58 3e-06 >gb|ERN20004.1| hypothetical protein AMTR_s00071p00160110 [Amborella trichopoda] Length = 294 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = +2 Query: 479 LEEEEYIQIQESVYYSKEIPNQ*FLKSIDSLLQELKGQGYIGENPL 616 + EEEY IQE+VYY KE N+ F++ LLQE K QGYIGE+PL Sbjct: 158 MNEEEYRSIQEAVYYGKEGTNERFVQRFSKLLQEFKAQGYIGEDPL 203 >gb|ERN20008.1| hypothetical protein AMTR_s00071p00160560 [Amborella trichopoda] Length = 759 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = +2 Query: 479 LEEEEYIQIQESVYYSKEIPNQ*FLKSIDSLLQELKGQGYIGENPL 616 + EEEY IQE+VYY KE N+ F++ LLQE K QGYIGE+PL Sbjct: 501 MNEEEYRSIQEAVYYGKERTNERFVQRFSKLLQEFKDQGYIGEDPL 546