BLASTX nr result
ID: Cheilocostus21_contig00063101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00063101 (689 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009392718.1| PREDICTED: beta-taxilin [Musa acuminata subs... 62 2e-07 >ref|XP_009392718.1| PREDICTED: beta-taxilin [Musa acuminata subsp. malaccensis] ref|XP_018679696.1| PREDICTED: beta-taxilin [Musa acuminata subsp. malaccensis] Length = 440 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 562 METCPANYLPEVDSLPEGFVEVSAD-ASLPTSDYKEAFLDVRP 687 MET PAN LPE DSLP+GFVEVSAD S P+SDYK+A LD+ P Sbjct: 1 METSPANRLPEADSLPDGFVEVSADPPSPPSSDYKDALLDLHP 43