BLASTX nr result
ID: Cheilocostus21_contig00060841
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00060841 (1468 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA58784.1| Receptor-like serine/threonine-protein kinase [Ap... 60 7e-06 ref|XP_009397532.1| PREDICTED: probable receptor-like protein ki... 60 7e-06 >gb|PKA58784.1| Receptor-like serine/threonine-protein kinase [Apostasia shenzhenica] Length = 527 Score = 60.1 bits (144), Expect = 7e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 113 LNVIYFVF*GQKEWLTEVDVLGVLEHPNLVKLIGYCA 3 L V+ F G KEWLTEV+VLGV+EHPNLVKLIGYCA Sbjct: 162 LFVVNFKMLGHKEWLTEVNVLGVVEHPNLVKLIGYCA 198 >ref|XP_009397532.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa acuminata subsp. malaccensis] ref|XP_009397533.1| PREDICTED: probable receptor-like protein kinase At5g47070 [Musa acuminata subsp. malaccensis] Length = 408 Score = 59.7 bits (143), Expect = 7e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 86 GQKEWLTEVDVLGVLEHPNLVKLIGYCA 3 G KEWLTEVDVLGV+EHPNLVKLIGYCA Sbjct: 127 GHKEWLTEVDVLGVVEHPNLVKLIGYCA 154