BLASTX nr result
ID: Cheilocostus21_contig00059995
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00059995 (1939 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OWM72270.1| hypothetical protein CDL15_Pgr018155 [Punica gran... 44 2e-06 gb|ABI34329.1| Integrase core domain containing protein [Solanum... 39 4e-06 gb|AFN88207.1| integrase core domain containing protein [Phaseol... 44 9e-06 >gb|OWM72270.1| hypothetical protein CDL15_Pgr018155 [Punica granatum] Length = 1054 Score = 44.3 bits (103), Expect(3) = 2e-06 Identities = 41/127 (32%), Positives = 53/127 (41%), Gaps = 12/127 (9%) Frame = +3 Query: 1473 HHLYVVMTLLIHINVPWHFWND-ICIAYYLI-----------IEFLWLF*RVLHLSSLFI 1616 H + + TLLIH+NVP FW D + A YLI I FL LF R Sbjct: 284 HLVETLRTLLIHMNVPVKFWGDALLTACYLINRMPSSVLHGQIPFLVLFPR--------- 334 Query: 1617 SATFSSPTFYFRMSMLSSHVWS*IDKLSPYVVYGIFFLYS*TQKGLSIL*SSELCFCING 1796 A +S P F + KLSP + +F Y QKG + + + Sbjct: 335 DAIYSLPPRIFGCLCFVHQLLPGSSKLSPRSLKCVFLGYPRGQKGYRCYSLEQRRYFVIA 394 Query: 1797 DVTFYES 1817 DVTF+ES Sbjct: 395 DVTFFES 401 Score = 32.0 bits (71), Expect(3) = 2e-06 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +1 Query: 1213 TKDGFKCFATSIDDYSRMF*LYLLK 1287 + G++ F T IDDYSRM +YLLK Sbjct: 189 SSQGYRYFVTFIDDYSRMTWVYLLK 213 Score = 25.4 bits (54), Expect(3) = 2e-06 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = +2 Query: 1283 SNVFDEFHAFYAK*KYILVFI*KFLHIDITLKYIKSKFRQFCISCGIIY*TTYPYVSQ 1456 S+++ F +F + + + + L D +Y + F+ + S GII+ ++Y Y Q Sbjct: 216 SDLYSTFVSFCTEIQTQFGVLIRTLRSDNAREYFSASFQSYMSSRGIIHQSSYAYTPQ 273 >gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum] Length = 1775 Score = 39.3 bits (90), Expect(3) = 4e-06 Identities = 35/121 (28%), Positives = 53/121 (43%), Gaps = 3/121 (2%) Frame = +3 Query: 1473 HHLYVVMTLLIHINVPWHFWND-ICIAYYLI--IEFLWLF*RVLHLSSLFISATFSSPTF 1643 H + TLL+ NVP FW D + + YLI + + +V H S + P Sbjct: 650 HLIETARTLLLESNVPLRFWGDAVLTSCYLINRMPSSSIQNQVPHSILFPQSHLYPIPPR 709 Query: 1644 YFRMSMLSSHVWS*IDKLSPYVVYGIFFLYS*TQKGLSIL*SSELCFCINGDVTFYESIV 1823 F + ++ DKL+P + +F YS QKG + ++ DVTF+ES Sbjct: 710 VFGSTCFVHNLAPGKDKLAPRALKCVFLGYSRVQKGYRCYSHDLHRYLMSADVTFFESQP 769 Query: 1824 Y 1826 Y Sbjct: 770 Y 770 Score = 35.8 bits (81), Expect(3) = 4e-06 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +2 Query: 1283 SNVFDEFHAFYAK*KYILVFI*KFLHIDITLKYIKSKFRQFCISCGIIY*TTYPYVSQ 1456 S +F F +F+A+ + + D L+Y+ S+FR+F GII+ TT PY Q Sbjct: 582 SELFSIFKSFFAEIQNQFGVSIRTFRSDNALEYLSSQFREFMTHQGIIHQTTCPYTPQ 639 Score = 25.4 bits (54), Expect(3) = 4e-06 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 1222 GFKCFATSIDDYSRMF*LYLLK 1287 GF+ F + IDDYS+ ++L+K Sbjct: 558 GFRYFVSFIDDYSKCTWVFLMK 579 >gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris] Length = 1387 Score = 43.5 bits (101), Expect(3) = 9e-06 Identities = 38/121 (31%), Positives = 55/121 (45%), Gaps = 3/121 (2%) Frame = +3 Query: 1473 HHLYVVMTLLIHINVPWHFWNDICI-AYYLI--IEFLWLF*RVLHLSSLFISATFSSPTF 1643 H + T+LIH +VP HFW D + A YLI + L ++ H S P Sbjct: 645 HLVETTRTILIHGDVPQHFWGDAVLSACYLINRMPSSVLDNKIPHSILFPHDPLHSLPPK 704 Query: 1644 YFRMSMLSSHVWS*IDKLSPYVVYGIFFLYS*TQKGLSIL*SSELCFCINGDVTFYESIV 1823 F + + +DKLSP +F ++ +QKG S + I+ DVTF ES + Sbjct: 705 VFGSTCFVHNFSPGLDKLSPRSHKCVFLGFTRSQKGYKCFSPSLNRYFISADVTFSESSL 764 Query: 1824 Y 1826 Y Sbjct: 765 Y 765 Score = 28.1 bits (61), Expect(3) = 9e-06 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +2 Query: 1283 SNVFDEFHAFYAK*KYILVFI*KFLHIDITLKYIKSKFRQFCISCGIIY*TTYPYVSQ 1456 S +F F FY + K + L D +Y+ F+ F S GI++ T+ Y Q Sbjct: 577 SELFSIFQLFYNEIKNQFGISIRILRSDNGREYLSHSFKNFMASHGILHQTSCAYTPQ 634 Score = 27.7 bits (60), Expect(3) = 9e-06 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 1222 GFKCFATSIDDYSRMF*LYLLK 1287 GF+ F T IDDYSR ++L+K Sbjct: 553 GFQYFVTFIDDYSRCTWVFLMK 574