BLASTX nr result
ID: Cheilocostus21_contig00058877
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00058877 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV44334.1| hypothetical protein F511_18136 [Dorcoceras hygro... 57 2e-06 gb|KZV25004.1| Cysteine-rich RLK (receptor-like protein kinase) ... 56 5e-06 >gb|KZV44334.1| hypothetical protein F511_18136 [Dorcoceras hygrometricum] Length = 442 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/63 (38%), Positives = 42/63 (66%) Frame = +2 Query: 254 ISYAQLSTTHPAYVPTASSIITPKSFFKTILVSKWTTTINEEIEALLLRKTWTLVSPPLG 433 + Y+ LS +H +V SS+I P +F + +++ +W +N+E++AL L TW++VS PLG Sbjct: 269 VDYSNLSPSHRNFVNNVSSVIEPTTFSQAVVLPEWRQAMNDELKALELNHTWSVVSLPLG 328 Query: 434 FSL 442 S+ Sbjct: 329 KSM 331 >gb|KZV25004.1| Cysteine-rich RLK (receptor-like protein kinase) 8 [Dorcoceras hygrometricum] Length = 1404 Score = 55.8 bits (133), Expect = 5e-06 Identities = 24/62 (38%), Positives = 43/62 (69%) Frame = +2 Query: 254 ISYAQLSTTHPAYVPTASSIITPKSFFKTILVSKWTTTINEEIEALLLRKTWTLVSPPLG 433 ++Y++LS++H A+V SSI+ P +F + + + +W ++EE++AL L TW++VS P G Sbjct: 870 VNYSKLSSSHRAFVQNISSILEPTTFSQAVSLPEWRQAMDEELKALELNHTWSIVSLPQG 929 Query: 434 FS 439 S Sbjct: 930 KS 931