BLASTX nr result
ID: Cheilocostus21_contig00058573
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00058573 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009410981.1| PREDICTED: putative calcium-transporting ATP... 61 6e-08 >ref|XP_009410981.1| PREDICTED: putative calcium-transporting ATPase 13, plasma membrane-type isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_018684997.1| PREDICTED: putative calcium-transporting ATPase 13, plasma membrane-type isoform X2 [Musa acuminata subsp. malaccensis] Length = 1024 Score = 61.2 bits (147), Expect = 6e-08 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 9/61 (14%) Frame = -3 Query: 157 AYAMIYSCRAIRSLARKQINNILRNSSYITIDVDA---------PSFSHVDTHVLKSLVK 5 A+AMI SCRAI SLA+KQ ++LR+ S++ ++V A PSFSHV+T LKSLVK Sbjct: 22 AFAMICSCRAIYSLAKKQFASVLRSPSFVVLEVSADDDADHRSKPSFSHVETDSLKSLVK 81 Query: 4 E 2 E Sbjct: 82 E 82