BLASTX nr result
ID: Cheilocostus21_contig00058312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00058312 (565 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023929749.1| inositol-3-phosphate synthase-like [Quercus ... 55 2e-06 gb|AEN71829.1| 1L-myo-inositol 1-phosphate synthase, partial [Di... 55 7e-06 gb|AQK84539.1| Inositol-3-phosphate synthase isozyme 1 [Zea mays] 55 7e-06 gb|OAY71404.1| Inositol-3-phosphate synthase, partial [Ananas co... 53 8e-06 >ref|XP_023929749.1| inositol-3-phosphate synthase-like [Quercus suber] Length = 112 Score = 54.7 bits (130), Expect = 2e-06 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +1 Query: 460 SFLTTPFAKQVPPGTPVVNALAKQRAMLENILRAC 564 S+LT A VPPGTPVVNALAKQRAMLENILRAC Sbjct: 66 SYLTK--APLVPPGTPVVNALAKQRAMLENILRAC 98 >gb|AEN71829.1| 1L-myo-inositol 1-phosphate synthase, partial [Dimocarpus longan] Length = 181 Score = 54.7 bits (130), Expect = 7e-06 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +1 Query: 460 SFLTTPFAKQVPPGTPVVNALAKQRAMLENILRAC 564 S+LT A VPPGTPVVNALAKQRAMLENILRAC Sbjct: 142 SYLTK--APLVPPGTPVVNALAKQRAMLENILRAC 174 >gb|AQK84539.1| Inositol-3-phosphate synthase isozyme 1 [Zea mays] Length = 207 Score = 55.1 bits (131), Expect = 7e-06 Identities = 28/37 (75%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = +1 Query: 457 NSFLTTPFAKQ-VPPGTPVVNALAKQRAMLENILRAC 564 +S LT P VPPGTPVVNALAKQRAMLENI+RAC Sbjct: 157 DSLLTAPIILDLVPPGTPVVNALAKQRAMLENIMRAC 193 >gb|OAY71404.1| Inositol-3-phosphate synthase, partial [Ananas comosus] Length = 117 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 481 AKQVPPGTPVVNALAKQRAMLENILRAC 564 A VPPGTPVVNALAKQRAMLENI+RAC Sbjct: 76 APLVPPGTPVVNALAKQRAMLENIMRAC 103