BLASTX nr result
ID: Cheilocostus21_contig00057755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00057755 (901 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73536.1| hypothetical protein VITISV_042993 [Vitis vinifera] 60 2e-06 >emb|CAN73536.1| hypothetical protein VITISV_042993 [Vitis vinifera] Length = 594 Score = 60.1 bits (144), Expect = 2e-06 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = -3 Query: 845 IFHGRAKYSEASNHFVRDIVMLKKICTPFTSSRNQIADMFIKPLINKILSTL 690 +FH R K+ E HFVR++V KKICTPFT S++Q+ADMF K L L+ L Sbjct: 530 VFHERTKHIEVDCHFVRNVVTSKKICTPFTPSKDQVADMFTKALKKDDLNRL 581