BLASTX nr result
ID: Cheilocostus21_contig00057499
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00057499 (712 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024183693.1| OTU domain-containing protein DDB_G0284757 i... 59 8e-07 ref|XP_020677966.1| OTU domain-containing protein DDB_G0284757 [... 59 1e-06 ref|XP_009386575.1| PREDICTED: OTU domain-containing protein DDB... 58 1e-06 gb|OAY65284.1| OTU domain-containing protein, partial [Ananas co... 57 3e-06 gb|PKA59402.1| hypothetical protein AXF42_Ash019556 [Apostasia s... 57 3e-06 gb|OAY77247.1| OTU domain-containing protein [Ananas comosus] 57 3e-06 ref|XP_020581498.1| OTU domain-containing protein DDB_G0284757 [... 57 5e-06 >ref|XP_024183693.1| OTU domain-containing protein DDB_G0284757 isoform X2 [Rosa chinensis] Length = 199 Score = 58.5 bits (140), Expect = 8e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 710 FQAKICLLTSFRDTCFVEIIPHNQSPQRGNFEKC 609 F+AKICLLTSFRDTCF+EI+P Q P+RG F+ C Sbjct: 165 FEAKICLLTSFRDTCFIEIMPQFQPPKRGKFKSC 198 >ref|XP_020677966.1| OTU domain-containing protein DDB_G0284757 [Dendrobium catenatum] ref|XP_020677967.1| OTU domain-containing protein DDB_G0284757 [Dendrobium catenatum] ref|XP_020677968.1| OTU domain-containing protein DDB_G0284757 [Dendrobium catenatum] gb|PKU79551.1| hypothetical protein MA16_Dca000897 [Dendrobium catenatum] Length = 229 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 710 FQAKICLLTSFRDTCFVEIIPHNQSPQR 627 F AKICLLTSFRDTCFVEI+PHNQ+PQR Sbjct: 168 FGAKICLLTSFRDTCFVEIVPHNQTPQR 195 >ref|XP_009386575.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Musa acuminata subsp. malaccensis] Length = 227 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 710 FQAKICLLTSFRDTCFVEIIPHNQSPQR 627 FQAKICLLTSFRDTCFVEI+P NQ+PQR Sbjct: 166 FQAKICLLTSFRDTCFVEIVPQNQAPQR 193 >gb|OAY65284.1| OTU domain-containing protein, partial [Ananas comosus] Length = 220 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 710 FQAKICLLTSFRDTCFVEIIPHNQSPQRGNF 618 F AKICLLTSFRDTCFVEI+P NQ P+RG++ Sbjct: 168 FAAKICLLTSFRDTCFVEIVPRNQPPKRGSY 198 >gb|PKA59402.1| hypothetical protein AXF42_Ash019556 [Apostasia shenzhenica] Length = 227 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -3 Query: 710 FQAKICLLTSFRDTCFVEIIPHNQSPQR 627 F AKICLLTSFRDTCF+EI+PHNQ PQR Sbjct: 166 FGAKICLLTSFRDTCFIEIVPHNQPPQR 193 >gb|OAY77247.1| OTU domain-containing protein [Ananas comosus] Length = 235 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 710 FQAKICLLTSFRDTCFVEIIPHNQSPQRGNF 618 F AKICLLTSFRDTCFVEI+P NQ P+RG++ Sbjct: 168 FAAKICLLTSFRDTCFVEIVPRNQPPKRGSY 198 >ref|XP_020581498.1| OTU domain-containing protein DDB_G0284757 [Phalaenopsis equestris] Length = 227 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -3 Query: 710 FQAKICLLTSFRDTCFVEIIPHNQSPQR 627 F AKICLLTSFRDTCFVEI+PHNQ+P+R Sbjct: 166 FGAKICLLTSFRDTCFVEILPHNQAPRR 193