BLASTX nr result
ID: Cheilocostus21_contig00057100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00057100 (926 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIW02047.1| hypothetical protein TanjilG_21096 [Lupinus angus... 59 2e-06 >gb|OIW02047.1| hypothetical protein TanjilG_21096 [Lupinus angustifolius] Length = 251 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/79 (35%), Positives = 41/79 (51%) Frame = -2 Query: 814 GKYVRVCVEIDLK*LIREGVWFGQPSFDFFQICSFKNLPTLCAGCDYLGHSIAQCPRVIK 635 G + V V+I+LK + E + Q F FF +KNLP LC+GC Y+ H ++ C ++ K Sbjct: 96 GHFANVLVDINLKATLPEQILVEQEGFSFFVSIEYKNLPDLCSGCHYISHLVSNCRKMAK 155 Query: 634 NKSQSRAGEILSTPCNSAP 578 N +I P S P Sbjct: 156 NDGAEEVSKI-KNPSTSKP 173