BLASTX nr result
ID: Cheilocostus21_contig00057069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00057069 (1313 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020695404.1| pentatricopeptide repeat-containing protein ... 61 3e-06 ref|XP_010257744.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-06 gb|PNX93712.1| pentatricopeptide repeat-containing protein mitoc... 60 5e-06 ref|XP_003624580.1| PPR containing plant-like protein [Medicago ... 60 6e-06 gb|KHN46803.1| Pentatricopeptide repeat-containing protein, mito... 60 7e-06 ref|XP_018806342.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-06 gb|OVA03900.1| Pentatricopeptide repeat [Macleaya cordata] 60 8e-06 ref|XP_018806341.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-06 ref|XP_012092708.1| pentatricopeptide repeat-containing protein ... 60 8e-06 ref|XP_018806337.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-06 ref|XP_014491196.1| pentatricopeptide repeat-containing protein ... 60 8e-06 ref|XP_017418520.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-06 ref|XP_007161768.1| hypothetical protein PHAVU_001G0968000g [Pha... 60 8e-06 ref|XP_007146988.1| hypothetical protein PHAVU_006G087100g [Phas... 60 8e-06 ref|XP_003548477.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-06 ref|XP_007161769.1| hypothetical protein PHAVU_001G0968000g, par... 60 8e-06 gb|KHN08170.1| Pentatricopeptide repeat-containing protein, mito... 59 9e-06 >ref|XP_020695404.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Dendrobium catenatum] gb|PKU63663.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 573 Score = 60.8 bits (146), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+RR Sbjct: 136 FTFFLWAGKQPGYTHSVREYHSMISILGKMRR 167 >ref|XP_010257744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Nelumbo nucifera] ref|XP_010257745.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Nelumbo nucifera] Length = 588 Score = 60.8 bits (146), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYHAMI IL K+R+ Sbjct: 155 FTFFLWAGKQPGYTHSVREYHAMISILGKMRK 186 >gb|PNX93712.1| pentatricopeptide repeat-containing protein mitochondrial-like [Trifolium pratense] Length = 606 Score = 60.5 bits (145), Expect = 5e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI +L K+RR Sbjct: 170 FTFFLWAGKQPGYAHSVREYHSMISVLGKMRR 201 >ref|XP_003624580.1| PPR containing plant-like protein [Medicago truncatula] gb|AES80798.1| PPR containing plant-like protein [Medicago truncatula] Length = 585 Score = 60.1 bits (144), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY HSVREYH+MI +L K+RR Sbjct: 149 FTFFLWAGKQPGYDHSVREYHSMISVLGKMRR 180 >gb|KHN46803.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 478 Score = 59.7 bits (143), Expect = 7e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 42 FTFFLWAGKQPGYAHSVREYHSMISILGKMRK 73 >ref|XP_018806342.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial isoform X3 [Juglans regia] Length = 548 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 112 FTFFLWAGKQPGYAHSVREYHSMISILGKMRK 143 >gb|OVA03900.1| Pentatricopeptide repeat [Macleaya cordata] Length = 549 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 111 FTFFLWAGKQPGYTHSVREYHSMISILGKMRK 142 >ref|XP_018806341.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial isoform X2 [Juglans regia] Length = 557 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 121 FTFFLWAGKQPGYAHSVREYHSMISILGKMRK 152 >ref|XP_012092708.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Jatropha curcas] ref|XP_012092709.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Jatropha curcas] ref|XP_020541432.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Jatropha curcas] ref|XP_020541433.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Jatropha curcas] Length = 585 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 149 FTFFLWAGRQPGYAHSVREYHSMISILGKMRK 180 >ref|XP_018806337.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial isoform X1 [Juglans regia] ref|XP_018806338.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial isoform X1 [Juglans regia] ref|XP_018806340.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial isoform X1 [Juglans regia] Length = 600 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 164 FTFFLWAGKQPGYAHSVREYHSMISILGKMRK 195 >ref|XP_014491196.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Vigna radiata var. radiata] ref|XP_014491197.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Vigna radiata var. radiata] ref|XP_014491198.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Vigna radiata var. radiata] Length = 611 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 176 FTFFLWAGKQPGYTHSVREYHSMISILGKMRK 207 >ref|XP_017418520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Vigna angularis] ref|XP_017418521.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Vigna angularis] ref|XP_017418522.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Vigna angularis] gb|KOM38509.1| hypothetical protein LR48_Vigan03g189100 [Vigna angularis] dbj|BAT84897.1| hypothetical protein VIGAN_04236800 [Vigna angularis var. angularis] Length = 611 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 176 FTFFLWAGKQPGYTHSVREYHSMISILGKMRK 207 >ref|XP_007161768.1| hypothetical protein PHAVU_001G0968000g [Phaseolus vulgaris] gb|ESW33762.1| hypothetical protein PHAVU_001G0968000g [Phaseolus vulgaris] Length = 611 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 176 FTFFLWAGKQPGYAHSVREYHSMISILGKMRK 207 >ref|XP_007146988.1| hypothetical protein PHAVU_006G087100g [Phaseolus vulgaris] gb|ESW18982.1| hypothetical protein PHAVU_006G087100g [Phaseolus vulgaris] Length = 611 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 176 FTFFLWAGKQPGYAHSVREYHSMISILGKMRK 207 >ref|XP_003548477.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Glycine max] gb|KRH06751.1| hypothetical protein GLYMA_16G043600 [Glycine max] Length = 612 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 176 FTFFLWAGKQPGYAHSVREYHSMISILGKMRK 207 >ref|XP_007161769.1| hypothetical protein PHAVU_001G0968000g, partial [Phaseolus vulgaris] gb|ESW33763.1| hypothetical protein PHAVU_001G0968000g, partial [Phaseolus vulgaris] Length = 617 Score = 59.7 bits (143), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HSVREYH+MI IL K+R+ Sbjct: 176 FTFFLWAGKQPGYAHSVREYHSMISILGKMRK 207 >gb|KHN08170.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 478 Score = 59.3 bits (142), Expect = 9e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 1 FTFFLWAGAQPGYSHSVREYHAMIPILDKIRR 96 FTFFLWAG QPGY+HS+REYH+MI IL K+R+ Sbjct: 42 FTFFLWAGKQPGYAHSIREYHSMISILGKMRK 73